KEGG   Theileria annulata: TA10465Help
Entry
TA10465           CDS       T00253                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tan  Theileria annulata
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TA10465
   01230 Biosynthesis of amino acids
    TA10465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TA10465
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TA10465
Enzymes [BR:tan01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TA10465
Exosome [BR:tan04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TA10465
  Exosomal proteins of melanoma cells
   TA10465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4
AA seq 273 aa AA seqDB search
MNRDNRFCGWIDVDLSEEGEKQARDAAELMRPYNFRFGHVYTSILKRSLNTAQIVLETLN
HPEVEITRTWRLNERHYGALQGLDKEETAKKFGEAMVKVWRRSYDIRPPPVEESSEHYPA
NNPVFDVVPREFLPNGESLKLTLERVMPFWESEIVPELRKGKPVLVAGMYIRSYFILAHG
NSLRGLIKMLDKMTEAEIMEFNLPTCVPVVYELNEDLSVKSKKYLLDEESLKVSYTLSTH
HNQQQLNMIIGQDASRKQRNQKRIKRSKCLICF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagataaccgtttctgtggatggattgacgtagatctgagcgaagaaggagaa
aaacaagccagagatgcagcagagctaatgagaccatacaattttagatttggtcatgtt
tacacttccatcctaaaaaggtcgctcaacactgcacaaatagtcttggagacgttaaat
caccctgaagtcgaaataacgagaacttggaggcttaatgaacgacactatggagcactt
caaggattagataaggaggaaactgctaaaaagttcggagaagcgatggtcaaagtttgg
agaaggtcatatgatattagaccacccccagttgaagagtcaagtgaacattacccagcg
aataatccagtgtttgacgtggttccaagggagttcctgcctaacggagaaagcttaaag
ctaacattggagagagttatgccgttttgggaatcagagatagtacctgagctcagaaag
ggtaaacccgttcttgttgctggtatgtatattagatcttattttattttagcacatggt
aacagcctgagggggttgataaagatgttggataaaatgacagaagcagagattatggag
ttcaaccttccaacatgtgttccagtagtatacgaacttaatgaagacttatccgtgaag
agtaaaaagtaccttttagatgaggaatctttgaaggttagttacacattatctacccac
cacaatcaacaacaattaaatatgataataggccaagatgcaagcagaaagcaacgtaat
cagaagcggatcaaaagatcaaaatgcttgatttgtttttga

DBGET integrated database retrieval system