KEGG   Theileria annulata: TA10465Help
Entry
TA10465           CDS       T00253                                 

Definition
(RefSeq) phosphoglycerate mutase, putative
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tan  Theileria annulata
Pathway
tan00010  Glycolysis / Gluconeogenesis
tan00260  Glycine, serine and threonine metabolism
tan01100  Metabolic pathways
tan01110  Biosynthesis of secondary metabolites
tan01130  Biosynthesis of antibiotics
tan01200  Carbon metabolism
tan01230  Biosynthesis of amino acids
Module
tan_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TA10465
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TA10465
Enzymes [BR:tan01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TA10465
Membrane trafficking [BR:tan04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TA10465
Exosome [BR:tan04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TA10465
  Exosomal proteins of melanoma cells
   TA10465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 3862677
NCBI-ProteinID: XP_953333
GeneDB: TA10465
UniProt: Q4U8Z5
Position
4
AA seq 273 aa AA seqDB search
MNRDNRFCGWIDVDLSEEGEKQARDAAELMRPYNFRFGHVYTSILKRSLNTAQIVLETLN
HPEVEITRTWRLNERHYGALQGLDKEETAKKFGEAMVKVWRRSYDIRPPPVEESSEHYPA
NNPVFDVVPREFLPNGESLKLTLERVMPFWESEIVPELRKGKPVLVAGMYIRSYFILAHG
NSLRGLIKMLDKMTEAEIMEFNLPTCVPVVYELNEDLSVKSKKYLLDEESLKVSYTLSTH
HNQQQLNMIIGQDASRKQRNQKRIKRSKCLICF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagataaccgtttctgtggatggattgacgtagatctgagcgaagaaggagaa
aaacaagccagagatgcagcagagctaatgagaccatacaattttagatttggtcatgtt
tacacttccatcctaaaaaggtcgctcaacactgcacaaatagtcttggagacgttaaat
caccctgaagtcgaaataacgagaacttggaggcttaatgaacgacactatggagcactt
caaggattagataaggaggaaactgctaaaaagttcggagaagcgatggtcaaagtttgg
agaaggtcatatgatattagaccacccccagttgaagagtcaagtgaacattacccagcg
aataatccagtgtttgacgtggttccaagggagttcctgcctaacggagaaagcttaaag
ctaacattggagagagttatgccgttttgggaatcagagatagtacctgagctcagaaag
ggtaaacccgttcttgttgctggtatgtatattagatcttattttattttagcacatggt
aacagcctgagggggttgataaagatgttggataaaatgacagaagcagagattatggag
ttcaaccttccaacatgtgttccagtagtatacgaacttaatgaagacttatccgtgaag
agtaaaaagtaccttttagatgaggaatctttgaaggttagttacacattatctacccac
cacaatcaacaacaattaaatatgataataggccaagatgcaagcagaaagcaacgtaat
cagaagcggatcaaaagatcaaaatgcttgatttgtttttga

DBGET integrated database retrieval system