KEGG   Theileria annulata: TA10540Help
Entry
TA10540           CDS       T00253                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tan  Theileria annulata
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TA10540
   01230 Biosynthesis of amino acids
    TA10540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TA10540
   00051 Fructose and mannose metabolism
    TA10540
   00562 Inositol phosphate metabolism
    TA10540
Enzymes [BR:tan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TA10540
Exosome [BR:tan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TA10540
  Exosomal proteins of bladder cancer cells
   TA10540
  Exosomal proteins of melanoma cells
   TA10540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4
AA seq 371 aa AA seqDB search
MYYTTLISFFHYVYFMNFFNFNIFKIILLFYIIFHFILYFNFVESYKFHNGNHHYLNVRN
NCFNFNTFLKPIHTRKNRFNCPNTCYNNSKLYNSNSQNENIFKNEDENLVEKIDLKGKKL
TIVCNWKCYLNTKLSNEMINLYGNLRFPENIEVITSPSSIHLASMVSQYNKFGSKCKPCS
QNVSHHSNSFGPYTGEITAGMLKDLGVNWTIIGHRECEIPSKSSDENNEAINRKVINAFN
SGLNVILCIGEPKGFNSDLSSYLSKQLEVKNKDVNLSGEQRLVVAYEPYYSIGTDKPAEP
ELVNKVIEDLKKSLGKMIKDVKFIYGGSVNEENAHLYIKRRNIDGIMVGRVAHSEKIVEL
MKKFEKLTSMV
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtattacactactttaatttcattttttcattatgtatattttatgaatttctttaat
tttaatatatttaaaataatcttgttgttttatatcatttttcattttatattatatttt
aactttgtagaatcttacaagtttcataatggtaatcatcattatttgaacgtacgtaat
aattgttttaattttaacacatttttaaaaccaatacatactcggaagaatcgcttcaat
tgtcctaacacatgttataataatagtaaattgtacaatagtaattctcaaaatgagaat
atttttaaaaatgaagacgaaaatttagtcgagaagattgatttaaaagggaaaaagttg
acaatagtttgtaactggaagtgctatttgaacacgaaattgtcaaatgaaatgataaat
ttgtatggaaatcttagattcccggaaaatatagaagttataacttcaccttcctctata
catttggcctcaatggtctcacagtataataaatttggaagcaaatgtaaaccatgtagc
caaaacgttagtcatcactctaatagttttggcccatatacgggggaaataacggctgga
atgctaaaggatttgggagtaaattggacaattattggtcacagagagtgtgaaataccc
tctaaatccagcgacgaaaacaatgaagccataaacaggaaggttataaacgcatttaac
tcaggtctaaatgttattttgtgtattggggaacctaaggggtttaattcagatttgtca
agttatctctccaaacaattggaggtaaaaaataaggatgtaaatttatctggagaacaa
agactagtagtggcatatgagccatactactcaatagggacagataaaccagcggaacca
gaattggtgaataaagtgatagaagatttaaaaaaatcgctgggaaaaatgatcaaagac
gttaaattcatatatggaggatcagtaaatgaagaaaatgcacacctgtatataaaaagg
aggaacatagatggaatcatggttggaagggttgcacatagtgaaaagatagtggaacta
atgaaaaaatttgaaaaattaacgtcaatggtatag

DBGET integrated database retrieval system