KEGG   Theileria annulata: TA11045Help
Entry
TA11045           CDS       T00253                                 

Definition
cyclin
Orthology
K06634  
cyclin H
Organism
tan  Theileria annulata
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tan00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TA11045
  Replication and repair
   03420 Nucleotide excision repair
    TA11045
Transcription machinery [BR:tan03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TA11045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4
AA seq 319 aa AA seqDB search
MNCHRDDMVEKNNVSGIEFDWVKNSTHYKNWLIDSIDKLNSIQLNTYNNAVKLLQKRKFE
YKIPSFNDELWLIKYYSFQLSQFVNSNNLKPSVKETSLVLFNRFYLRRSLLEYDPRIIMF
TCITLATKLEDMWRSVYIDKLLYKINNLNITKVFEMESIVCDVLNFNLNILHLNDSIYIL
IQLLISYIKESLDVDGINEYIGIILYMLKEAEMSALIMNESPSLTFLYTPPQLTLSIILQ
LIKNTSLSTILSIESFVLKLLNGDEKNLMKLLSLTQSIMDEYNEFLAFRNELNQSKALPT
PKCMVISFYSQVYTNKSIE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtcatcgagatgacatggtagaaaaaaataatgtgtctggaattgagtttgac
tgggtcaagaattctactcattataagaattggttgattgattccattgataaactcaat
tctatacaacttaacacttataataatgctgttaaattattacaaaaacgtaaatttgaa
tataagattccaagttttaatgatgaactttggcttattaaatattattcatttcaatta
tcgcaatttgttaattcaaataatcttaaaccttctgttaaagaaacatcattagtattg
tttaatagattttatttaagacgttcattacttgaatatgatccaagaattataatgttt
acttgtattacacttgctactaaacttgaagatatgtggcgtagtgtttatattgataaa
ttattatataaaattaataatctaaatataacaaaagtatttgaaatggaatctatagtt
tgtgatgtattaaatttcaatttgaacattttacatcttaatgattctatttatatatta
atacaacttctcatttcctatataaaagaaagtcttgatgtggatggtataaatgaatat
attggtataatattatatatgttaaaagaggcagaaatgagtgcattaataatgaatgaa
agtccatcattaactttcttatatacaccaccacaacttacattatcaataattctacaa
cttattaaaaatacttcattatcaactatactctccattgaatcatttgtattgaaatta
ttgaatggagatgaaaagaatttaatgaaattattatcattaacacaatcaattatggat
gaatataatgagtttttggcctttagaaatgaattaaatcaatctaaagcactccctact
cccaagtgtatggtaataagtttctattcccaagtctatactaacaaatctattgaatag

DBGET integrated database retrieval system