KEGG   Theileria annulata: TA11045Help
Entry
TA11045           CDS       T00253                                 

Definition
(RefSeq) cyclin, putative
  KO
K06634  cyclin H
Organism
tan  Theileria annulata
Pathway
tan03022  Basal transcription factors
tan03420  Nucleotide excision repair
Module
tan_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tan00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TA11045
  Replication and repair
   03420 Nucleotide excision repair
    TA11045
Transcription machinery [BR:tan03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TA11045
DNA repair and recombination proteins [BR:tan03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     TA11045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 3862865
NCBI-ProteinID: XP_953228
GeneDB: TA11045
UniProt: Q4U9A0
Position
4
AA seq 319 aa AA seqDB search
MNCHRDDMVEKNNVSGIEFDWVKNSTHYKNWLIDSIDKLNSIQLNTYNNAVKLLQKRKFE
YKIPSFNDELWLIKYYSFQLSQFVNSNNLKPSVKETSLVLFNRFYLRRSLLEYDPRIIMF
TCITLATKLEDMWRSVYIDKLLYKINNLNITKVFEMESIVCDVLNFNLNILHLNDSIYIL
IQLLISYIKESLDVDGINEYIGIILYMLKEAEMSALIMNESPSLTFLYTPPQLTLSIILQ
LIKNTSLSTILSIESFVLKLLNGDEKNLMKLLSLTQSIMDEYNEFLAFRNELNQSKALPT
PKCMVISFYSQVYTNKSIE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtcatcgagatgacatggtagaaaaaaataatgtgtctggaattgagtttgac
tgggtcaagaattctactcattataagaattggttgattgattccattgataaactcaat
tctatacaacttaacacttataataatgctgttaaattattacaaaaacgtaaatttgaa
tataagattccaagttttaatgatgaactttggcttattaaatattattcatttcaatta
tcgcaatttgttaattcaaataatcttaaaccttctgttaaagaaacatcattagtattg
tttaatagattttatttaagacgttcattacttgaatatgatccaagaattataatgttt
acttgtattacacttgctactaaacttgaagatatgtggcgtagtgtttatattgataaa
ttattatataaaattaataatctaaatataacaaaagtatttgaaatggaatctatagtt
tgtgatgtattaaatttcaatttgaacattttacatcttaatgattctatttatatatta
atacaacttctcatttcctatataaaagaaagtcttgatgtggatggtataaatgaatat
attggtataatattatatatgttaaaagaggcagaaatgagtgcattaataatgaatgaa
agtccatcattaactttcttatatacaccaccacaacttacattatcaataattctacaa
cttattaaaaatacttcattatcaactatactctccattgaatcatttgtattgaaatta
ttgaatggagatgaaaagaatttaatgaaattattatcattaacacaatcaattatggat
gaatataatgagtttttggcctttagaaatgaattaaatcaatctaaagcactccctact
cccaagtgtatggtaataagtttctattcccaagtctatactaacaaatctattgaatag

DBGET integrated database retrieval system