KEGG   Theileria annulata: TA12645Help
Entry
TA12645           CDS       T00253                                 

Definition
(RefSeq) ubiquitin carboxy-terminal hydrolase, putative
Organism
tan  Theileria annulata
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 3862270
NCBI-ProteinID: XP_952376
GeneDB: TA12645
UniProt: Q4UE45
Position
2
AA seq 632 aa AA seqDB search
MSNARTYLPYVIELHNKSIKFTKYSPSNSDLLNHSKLNTNEDDSQNKFKTFPVLKNLKNS
QIRGIYHLPKVKWDDESMTMGAGLNNPGINICYMNVIIQVLTHTPFLASSLLKSYHSKTC
LHYEKDIFCIMCLFENYVKKSFASPNPLNNPFYSIAKKFIWSRFKLGHQDDAFIFLKHFL
DSLSKACYLNSKESEKQEDGSETTSGPKDFISNDQIMSTVIGRLFGGYFRNVIVCNNCSR
KSEKVEEFFDLAVEVTKSNRLIDLLSEFVLPEKLTNDNKYFCSNCKSYQNANKSLSIYKA
PRILNINLKRFNLYSSVYKKSLKAIEFPQLLSISLKTSEDSYTWLNYDLYAIVCHIGKSL
HMGHYITFIKGKHGFWYRFDDSIIQCVSESTVLSHNNDVYLLFYSINNESVGDCDTALNL
FSYSNILKESKSSQSEPIATPEREPRRCEIDILSYFGGNTIFKRFLKHRKFKNYNLLNMK
ILSNIQRMNNLKRKINSIVTNNQENKETIQKINKKEKESKLKDTDTDLKSEVKCSLKHTS
FIDAIGDEDVSAEIELWSDAEDVETYNKLYEQIDPDLPKPTEEDLEYDRGKIHKSKNRNR
PNPANVELVNHRSGINVAVEQKNLFDNTVISP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgcgagaacatatttaccatatgtaatcgagctacacaataaaagtataaag
tttaccaagtatagtcccagtaattcggacttattaaatcattcaaaattaaacacaaac
gaagatgattcacaaaataaatttaaaacatttccagttttaaaaaacctaaaaaacagt
cagatcaggggaatataccacctgcctaaagtaaaatgggacgatgagtcaatgacaatg
ggagctgggctaaataacccaggaatcaacatctgttatatgaatgtaataattcaggtg
ttgacacatacgccgtttttagcctcatccttacttaagtcataccactcgaaaacatgc
ctacattacgaaaaggatatattttgtattatgtgcctatttgaaaattatgtaaagaag
tcatttgcgtcaccgaacccgttaaataatccgttttactccatcgcaaaaaagtttatc
tggtctagatttaaactaggccaccaagatgacgcattcatattcttaaaacattttcta
gattctctgtcaaaagcatgttacttaaactcaaaagagtctgagaaacaggaagatggt
tctgaaaccacgtctggtccaaaggattttatctctaatgaccaaattatgtccacagta
ataggaagattgtttggaggctattttagaaatgtaattgtttgcaataactgttcaagg
aagtcggaaaaggttgaagaattcttcgatttagcagtggaagtcacaaaaagtaataga
ctaatagatttgttgtcagaatttgtactaccagaaaagttaacgaacgataataagtac
ttttgcagtaactgcaagagttaccagaacgcaaataaatcattgtcgatatacaaggca
ccaagaatattaaacataaatctcaaaaggtttaatctatattctagcgtatacaaaaaa
tctttgaaagctattgaattcccacaactcttgtcaatctcactcaagacttcggaagat
tcatatacatggctcaattacgatttgtatgcaatagtgtgccacattggaaagtcactc
catatgggacactacataacatttatcaagggaaaacatggtttttggtatcgttttgac
gattcaataatacagtgcgtttcagaatcaacagttttatctcataacaacgacgtttat
ctattattctactcgattaacaacgaatctgttggagattgtgacacagcactgaacctg
ttttcctatagtaatattttaaaggagtccaaatcctcacaatcagaaccaattgcaaca
cctgaacgggaacccagacgctgtgaaattgatatactttcatattttggagggaacacg
atttttaaaagatttctaaagcacagaaagtttaaaaactacaatttattaaacatgaag
atcctgtcaaacatccaaaggatgaataatttgaaaagaaaaatcaattcaatagtgact
aacaatcaagaaaataaagaaacgatacagaagattaataaaaaggaaaaagaatccaag
ttaaaggatactgatacagatttaaagagtgaagttaaatgtagtttaaaacacacatca
ttcattgatgcaattggagatgaagatgtatctgcagaaattgagctttggtccgatgct
gaggacgtagaaacatataataaactctacgaacaaatcgaccccgatttaccgaaaccc
acagaagaagatttagagtacgacagagggaaaattcacaagtcaaagaacagaaatcga
ccaaatccagcaaatgtcgagttagttaaccatcgctctggcattaatgtggcagttgaa
cagaagaatctattcgacaacacagtgatttcaccataa

DBGET integrated database retrieval system