KEGG   Theileria annulata: TA12645Help
Entry
TA12645           CDS       T00253                                 

Definition
ubiquitin carboxy-terminal hydrolase
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
tan  Theileria annulata
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 632 aa AA seqDB search
MSNARTYLPYVIELHNKSIKFTKYSPSNSDLLNHSKLNTNEDDSQNKFKTFPVLKNLKNS
QIRGIYHLPKVKWDDESMTMGAGLNNPGINICYMNVIIQVLTHTPFLASSLLKSYHSKTC
LHYEKDIFCIMCLFENYVKKSFASPNPLNNPFYSIAKKFIWSRFKLGHQDDAFIFLKHFL
DSLSKACYLNSKESEKQEDGSETTSGPKDFISNDQIMSTVIGRLFGGYFRNVIVCNNCSR
KSEKVEEFFDLAVEVTKSNRLIDLLSEFVLPEKLTNDNKYFCSNCKSYQNANKSLSIYKA
PRILNINLKRFNLYSSVYKKSLKAIEFPQLLSISLKTSEDSYTWLNYDLYAIVCHIGKSL
HMGHYITFIKGKHGFWYRFDDSIIQCVSESTVLSHNNDVYLLFYSINNESVGDCDTALNL
FSYSNILKESKSSQSEPIATPEREPRRCEIDILSYFGGNTIFKRFLKHRKFKNYNLLNMK
ILSNIQRMNNLKRKINSIVTNNQENKETIQKINKKEKESKLKDTDTDLKSEVKCSLKHTS
FIDAIGDEDVSAEIELWSDAEDVETYNKLYEQIDPDLPKPTEEDLEYDRGKIHKSKNRNR
PNPANVELVNHRSGINVAVEQKNLFDNTVISP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgcgagaacatatttaccatatgtaatcgagctacacaataaaagtataaag
tttaccaagtatagtcccagtaattcggacttattaaatcattcaaaattaaacacaaac
gaagatgattcacaaaataaatttaaaacatttccagttttaaaaaacctaaaaaacagt
cagatcaggggaatataccacctgcctaaagtaaaatgggacgatgagtcaatgacaatg
ggagctgggctaaataacccaggaatcaacatctgttatatgaatgtaataattcaggtg
ttgacacatacgccgtttttagcctcatccttacttaagtcataccactcgaaaacatgc
ctacattacgaaaaggatatattttgtattatgtgcctatttgaaaattatgtaaagaag
tcatttgcgtcaccgaacccgttaaataatccgttttactccatcgcaaaaaagtttatc
tggtctagatttaaactaggccaccaagatgacgcattcatattcttaaaacattttcta
gattctctgtcaaaagcatgttacttaaactcaaaagagtctgagaaacaggaagatggt
tctgaaaccacgtctggtccaaaggattttatctctaatgaccaaattatgtccacagta
ataggaagattgtttggaggctattttagaaatgtaattgtttgcaataactgttcaagg
aagtcggaaaaggttgaagaattcttcgatttagcagtggaagtcacaaaaagtaataga
ctaatagatttgttgtcagaatttgtactaccagaaaagttaacgaacgataataagtac
ttttgcagtaactgcaagagttaccagaacgcaaataaatcattgtcgatatacaaggca
ccaagaatattaaacataaatctcaaaaggtttaatctatattctagcgtatacaaaaaa
tctttgaaagctattgaattcccacaactcttgtcaatctcactcaagacttcggaagat
tcatatacatggctcaattacgatttgtatgcaatagtgtgccacattggaaagtcactc
catatgggacactacataacatttatcaagggaaaacatggtttttggtatcgttttgac
gattcaataatacagtgcgtttcagaatcaacagttttatctcataacaacgacgtttat
ctattattctactcgattaacaacgaatctgttggagattgtgacacagcactgaacctg
ttttcctatagtaatattttaaaggagtccaaatcctcacaatcagaaccaattgcaaca
cctgaacgggaacccagacgctgtgaaattgatatactttcatattttggagggaacacg
atttttaaaagatttctaaagcacagaaagtttaaaaactacaatttattaaacatgaag
atcctgtcaaacatccaaaggatgaataatttgaaaagaaaaatcaattcaatagtgact
aacaatcaagaaaataaagaaacgatacagaagattaataaaaaggaaaaagaatccaag
ttaaaggatactgatacagatttaaagagtgaagttaaatgtagtttaaaacacacatca
ttcattgatgcaattggagatgaagatgtatctgcagaaattgagctttggtccgatgct
gaggacgtagaaacatataataaactctacgaacaaatcgaccccgatttaccgaaaccc
acagaagaagatttagagtacgacagagggaaaattcacaagtcaaagaacagaaatcga
ccaaatccagcaaatgtcgagttagttaaccatcgctctggcattaatgtggcagttgaa
cagaagaatctattcgacaacacagtgatttcaccataa

DBGET integrated database retrieval system