KEGG   Theileria annulata: TA12680Help
Entry
TA12680           CDS       T00253                                 

Definition
serine/threonine protein phosphatase 1, PP1-gamma catalytic subunit (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tan  Theileria annulata
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tan00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    TA12680
Enzymes [BR:tan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     TA12680
Protein phosphatases and associated proteins [BR:tan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     TA12680
Transcription machinery [BR:tan03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     TA12680
Spliceosome [BR:tan03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    TA12680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 301 aa AA seqDB search
MELNLDSIIERLLEVRGNRPIKSVQLSEDEIKGLCHKSREIFLSQSILLELEAPIKICGD
IHGQYYDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGN
HECASINRIYGFYDECKRRYSIKLWKAFTDCFNCLPVAAIIDDKIFCMHGGLSPELTTMD
QIRQISRPTDVPDTGLLCDLLWSDPDPNTTGWGENDRGVSFTFGSDIVVNFLAKHELDLI
CRAHQVVEDGYEFFSKRRLVTLFSAPNYCGEFDNAGAMMSVDKTLMCSFQILKPVDRKRL
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaactcaacttggatagtatcatagaaagactgctggaggtccggggtaaccgtcca
atcaagtcagtacaattaagcgaagacgaaattaaaggactttgccataaaagcagagaa
atcttcttatcgcaatcaatattgctagaattagaagcaccgatcaaaatctgcggtgat
atacacggacaatattacgacctcctcagactgttcgaatacggaggatttccaccggcg
gcaaattacctatttttaggagattatgtagaccgaggaaaacaaagcctcgaaacaata
tgcctacttctcgcttataaaatcaaataccccgaaaacttctttttattacgtggtaac
cacgaatgtgcatcaataaatcgaatttacggattctatgatgaatgtaaacgcagatat
agtataaaactttggaaagcattcactgattgcttcaattgtttaccagtcgcagccatt
atagatgacaagatcttctgtatgcatggcggactctctccagaattgacaacaatggac
caaataaggcagatttcaagacccacagatgttcccgacaccggacttctttgtgatctt
ttatggagtgaccctgaccctaatactactggttggggtgagaatgatcgcggtgtttca
ttcactttcgggtcagatattgttgtcaattttctggctaaacacgaacttgatcttatt
tgtcgcgctcatcaagttgtggaagacggatatgagtttttttcaaagagaaggcttgta
acgctatttagtgctccaaattactgtggagagtttgataatgctggtgcgatgatgagc
gttgataagacattaatgtgttcattccagatccttaaacctgttgatcgaaaacggtta
aaatga

DBGET integrated database retrieval system