KEGG   Theileria annulata: TA12690Help
Entry
TA12690           CDS       T00253                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tan  Theileria annulata
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 446 aa AA seqDB search
MEKRVSYFYDPDVGSFYYGPGHPMKPQRIRMAHALVLSYDLYRHMEIFRPHKAVEPELLS
FHDSEYVHFLSGVSPENYRDFTYQLKRFNVGEATDCPVFDGLYVFQQSCSGASIDAAHRL
NNQQADICVNWSGGLHHAKRSEASGFCYLNDIVLGILELLKYHARVMYIDIDVHHGDGVE
EAFYVTHRVMTISFHKFGNFFPGTGDVTDVGVSSGKYYSVNVPLNDGIDDESFVDLFKVV
VGKCVEVYCPGAIVLQCGADSLTGDRLGRFNLTIKGHAACVQYVRSLNIPLLVLGGGGYT
IRNVARCWAYETGVILNKHTDMSNQISLNDYYDYYAPDFQLHLTPSQMTNYNTKEHLDKI
KVKILDNLRYVEKSPGVQFAHVPADFLTRDDDVDEDLQKQIFDEGGGITTLSTRKRVSLM
TTHRLRRRDNKGEFYDLPDRDESIPL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcgtgtatcatatttttatgaccccgatgttggcagtttttactacgggcct
ggtcacccgatgaaacctcagagaattagaatggcccacgcattggtgctcagctatgac
ctgtacagacacatggaaatttttagacctcacaaggctgtagagccagagcttctttca
ttccatgactccgaatacgtccattttctctcgggtgtgagtcccgaaaattaccgcgac
ttcacctaccagttgaagagatttaatgtgggagaggcgacagactgcccagttttcgac
ggtttatacgtattccagcagtcgtgttctggagcttctatcgacgcggcacaccggctg
aacaatcaacaagctgatatttgcgttaactggtctgggggtctgcaccacgctaagaga
tctgaagcatctggtttctgctatctaaacgatattgttctgggcatcctggagcttctt
aaataccacgcaagggtgatgtacattgatatagatgtacatcatggtgatggtgtcgaa
gaagccttttatgttactcatcgtgttatgacaataagtttccacaaattcggaaacttt
ttccctggcaccggcgatgtgactgatgttggcgtatcctcgggtaaatattactctgta
aacgtgcctctaaacgacggaattgacgacgaatctttcgtagaccttttcaaagttgtg
gttggaaagtgtgtagaagtttactgtccgggcgctatagtgttacagtgcggtgcagac
tctcttactggagatcgcctggggcgctttaatctaaccatcaaaggccacgcggcctgt
gtacaatatgttagatcacttaatattcctcttttggtcttgggaggtggtggttataca
ataagaaacgttgctcgatgctgggcatatgaaactggtgttattctcaacaaacataca
gatatgtcaaaccaaatatctctcaatgattactatgactactacgctccagacttccag
ctccacctgactccgtcacagatgaccaactataacacgaaggaacacctcgacaagatt
aaagtgaagattctggacaacctgaggtatgtagaaaaatctcccggtgttcagtttgca
cacgtacctgcagacttccttactcgggacgatgatgtagatgaggatcttcaaaaacaa
atattcgacgaaggaggtggtatcactactttgtcaacaagaaagcgtgtatctttaatg
acaacccatagacttagaaggagggacaataagggtgaattctatgacttgccagataga
gacgagtccattccattgtaa

DBGET integrated database retrieval system