KEGG   Theileria annulata: TA12705Help
Entry
TA12705           CDS       T00253                                 

Definition
hypothetical protein
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tan  Theileria annulata
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 411 aa AA seqDB search
MAWPTRIPVIHIFVILFSSINLTLARQYVDPMQHDLQVVNSKTFTTNVQLARQTNVVGAF
FYSTGDTNLTSTINELNSVAKDLKGMITIVAVNCTDQSLKNLCKSELGEEYLTPAFKIYP
KLPMPAFDFKKELLKEDVKKELLKHLPSNVERVEVGMLAHFMTKHELMPKVLLFSDKEHP
SYVYKALSNAFNKKLLLGFVDANKHPDLKKEYGVKSLPTMLVIKPNGKPQKYKGEFKYLP
MFEWLNVNAEAFLLGGGYSDKGDPAKAKPWKFDKVPKLNFFSHKDICFNKTQGLCIIYLT
DSDLKPEEKEMLVHLSEKYTGQITGKWMWMNLNEETEFAQLFENVKVLPSAVVFNPKKRL
RYFLHDGNTSVTKSSMERMLEKILGGDARFTLVNGELPKFKIDDLLTTEEL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggccaacgaggattcctgtcattcatatatttgtcatattgttttcatctatt
aatctaacactagccagacaatatgtcgacccaatgcaacatgatttgcaagttgtaaat
tcaaaaacattcacaacgaacgtacaattggctcgccaaacaaatgtagtaggagcgttt
ttctattcaacaggagataccaacctcacctcaacgataaatgagttgaactcagtagca
aaagatctcaaagggatgattacaatcgtcgcagttaactgtacagaccagtcacttaag
aacctatgtaaaagtgaacttggagaagagtatttgacgccagcgttcaagatctatcca
aagttacctatgccagcatttgatttcaagaaagaattgttgaaagaagatgtgaagaag
gaacttttaaagcacctcccatcaaatgtggagagggtggaggttggaatgttggctcat
ttcatgacaaagcacgaattgatgccaaaggtgctgttattttctgacaaggagcatcct
tcgtatgtctacaaggcacttagcaacgctttcaacaaaaaactgttactgggattcgtt
gacgcgaacaaacacccggatctaaagaaggaatacggtgttaagagcctgccaacaatg
ttggtaattaaaccaaatggaaagccgcaaaagtataaaggagagttcaagtaccttcca
atgttcgagtggctaaatgtaaacgcagaagcgttcctacttggaggagggtattctgat
aaaggagatccagcaaaagcaaaaccatggaaatttgataaggtaccaaagttgaatttc
ttctcccataaagatatctgttttaataaaactcagggactgtgcatcatttatcttact
gattctgatttgaaaccagaagagaaggaaatgctggtccatttaagcgaaaagtacact
ggacaaattacgggaaagtggatgtggatgaacctgaatgaagagaccgagtttgcacaa
ctgttcgaaaatgtaaaggtattgccatcagcagtggtatttaacccgaagaagagactg
aggtacttcttacatgacggaaatacgtcagtaacaaaaagctcaatggaaagaatgttg
gaaaaaatactagggggagatgctagattcacactagtaaacggagaactccccaaattc
aagatagacgaccttttaaccacagaagaattgtaa

DBGET integrated database retrieval system