KEGG   Theileria annulata: TA12860Help
Entry
TA12860           CDS       T00253                                 

Definition
cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TA12860
Protein kinases [BR:tan01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   TA12860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 353 aa AA seqDB search
MYIDEETTGCVGSLIRSFKNLFSRKARYTVIKSVSIPKNTFLPKSLKFIKVLGQGGFGKV
FLAQKVEENSEFELCAVKRLQKHPLIVQKQVDHIISENKLLASVNHPFIVKHLGSYKDNH
YLYLVMEYVSSGDFFTYLRKENYLESHDAMFYAAQVTAMFEYLHDNNIIYRDLKPENLLL
CFDGYLKLTDFGFAKVVEFRTYTLCGTPEYMSPEIILHLGYGKAVDWWTLGILIYEMLAG
YPPFYDSNPQSLYDKILKCKLKFPIHYDEDAKYLTSRLLVTEPSQRFGNLHKGIDDIKKC
KWFESMDFDALVEKELSPPHIPERKEDLPAEEFIDSYRMPKEVTGEDDPFVDW
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtatatagacgaagaaactacaggatgtgttggaagcttaatcagatctttcaaaaat
ttattctccagaaaagccagatataccgtaatcaaatccgtgtcgattcccaaaaacaca
tttcttccaaagtcgctcaaattcataaaggttttgggacaaggagggtttggcaaggtg
tttttagcacaaaaggtagaagaaaactccgaatttgaactgtgtgcagtaaaaagacta
caaaagcacccactaatagtccaaaaacaagtggaccacatcatctcagaaaataaactc
ctggcctcggtcaaccatccattcatagtgaaacacctgggctcctataaggataatcat
tatctgtaccttgtaatggaatatgtttcatctggagacttcttcacatacttgaggaaa
gaaaattatttagagtcccatgatgctatgttctatgcagctcaggtcacagcaatgttc
gaatatctacacgataataatataatttatcgtgacttgaagccagaaaaccttttactt
tgtttcgatggttatttaaaactgactgatttcggattcgcaaaggttgttgagtttagg
acttacaccctctgtggaactccagaatacatgtcgcccgagatcattttacaccttgga
tatggaaaagctgtagattggtggactctgggaatactaatttatgaaatgctggcaggt
tatccaccattttacgattcaaacccacaaagtttgtacgataaaatacttaaatgtaaa
ctaaaattcccgattcattacgatgaggatgctaaatatttaacttcaagacttctagtt
accgaaccatctcaaaggttcgggaacttgcataaaggaatagatgatattaaaaaatgt
aaatggtttgagtccatggatttcgatgctttagttgaaaaggaattaagtccaccacat
attcccgaacggaaagaggatttaccagccgaagaatttattgattcttacagaatgccc
aaagaagtaactggagaagacgatccatttgtagattggtga

DBGET integrated database retrieval system