KEGG   Theileria annulata: TA12950Help
Entry
TA12950           CDS       T00253                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
tan  Theileria annulata
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TA12950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 115 aa AA seqDB search
MAKPEPDVVVPEGDPAKGAKLFKSKCAQCHTINKGGSVKQGPNLFGFYGRKSGSTDYAYS
DANKNSGIVWSDKHLFVYLVNPKQYIPGTKMVFAGLKKEQDRADLIAYLKEASSK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccggagcccgatgtcgtcgtcccagaaggggatccagcaaaaggggctaaa
ctcttcaagtccaaatgcgctcaatgccatacaataaataaaggaggaagtgtgaaacaa
ggacctaacctattcggtttttatggccgtaaatcaggatctaccgactacgcatattcc
gacgcaaataaaaattctggcatcgtatggtccgataaacatctctttgtgtacctggtc
aaccccaagcagtatattcccggaacaaaaatggtttttgccggattaaagaaggaacaa
gatagggcggatttaatagcatatctgaaggaagcatcttccaaataa

DBGET integrated database retrieval system