KEGG   Theileria annulata: TA13765Help
Entry
TA13765           CDS       T00253                                 

Definition
NADH-cytochrome b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tan  Theileria annulata
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TA13765
Enzymes [BR:tan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TA13765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 383 aa AA seqDB search
MDLNVCIDVEQYVKKEKIGINLKNNQESYLYDLELVEKIKSSPTSFVFVFEYPEEIRDVV
EVDIFSAFMFIGTHDTPSIPGTWNGIVLDEEDHQVKRKYTPIYIDVDKRLVHFLIRIYSP
TDLYPDGGKFTRYLDKFLPTETITFMPLKQKYKLITDNTIKALGKRIEFDTLNIAAGGTG
ITPFIRLLNYYQDLPYDINLIYCNRSVEEIMLKGLFDKLASINKRLKITYLASSGVPSED
LVITRITEEIVSKKFINTEKAVCLFCGPPGFNDLFDNLNRFVAKAIVLSKLVKLRLAQPM
LKGSVEDSNKSLSVSVKAVSFLTKIVPILKLAQALSNKSLVSSTVSKGTKKVGTVRLHNK
EEQIWRVLRPGYEKQTKHLRWRK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaatgtgtgtattgatgtggaacaatacgttaaaaaggaaaaaattggtata
aacttaaaaaataatcaagaatcgtatttgtatgaccttgaattggtagaaaaaattaaa
tcttccccaacttcttttgtttttgtatttgaataccccgaggaaattcgagatgtggta
gaagttgacatcttttcggcttttatgttcattggcacacacgacacaccctcgattcca
ggcacttggaatggcatagttttagacgaagaagatcaccaagtaaaaaggaaatatact
cccatttatatcgacgtcgataaaagattggtccactttcttattcgtatatactctcca
acagatttgtatccagacggagggaaattcacaagatatctagacaaatttctgccgaca
gaaaccataacattcatgcccttaaaacaaaagtacaagttgataactgataatacaata
aaggcactgggtaaaagaatcgaatttgatacgttaaacatagctgcagggggtactgga
ataactccctttataaggttgttgaattattaccaggatctgccatatgatattaacctg
atatactgcaatcggtcagtagaggagataatgctcaagggtctttttgataaacttgca
agcataaacaaaagacttaaaatcacatacttggcatcaagtggagttccatctgaggac
ttagttataaccaggataacggaggaaatcgtatcaaaaaagttcattaacactgaaaag
gcagtgtgtttattttgtggtccaccgggatttaacgatttgtttgataacctaaataga
tttgttgccaaggcgatagttttatcgaaattggtaaaactaaggcttgcacagccaatg
ctcaaaggaagtgttgaggactcaaacaagagtcttagcgtttctgtaaaggctgtttct
ttccttactaaaattgttccaattttaaagttagctcaggcactttcaaacaaatctctg
gtgtcctcaactgtatcaaaaggtaccaaaaaggtaggaacagttcgcttgcataacaag
gaggaacagatttggcgtgttttaaggccaggatatgaaaaacaaactaaacacttgaga
tggagaaaataa

DBGET integrated database retrieval system