KEGG   Theileria annulata: TA13945Help
Entry
TA13945           CDS       T00253                                 

Definition
(RefSeq) guanylate kinase, putative
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tan  Theileria annulata
Pathway
tan00230  Purine metabolism
tan01100  Metabolic pathways
Module
tan_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TA13945
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TA13945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 ABC_tran AAA_18 SRPRB Rad17 AAA_16 MobB AAA_14 cobW NB-ARC ATPase_2 TniB Roc AAA_29 RNA_helicase NACHT Mg_chelatase GST_N MMR_HSR1 AAA EFP RsgA_GTPase AAA_23 T2SSE AAA_5 AAA_24 AAA_17
Motif
Other DBs
NCBI-GeneID: 3861923
NCBI-ProteinID: XP_952139
GeneDB: TA13945
UniProt: Q4UET2
Position
2
AA seq 196 aa AA seqDB search
MLESIELPILIIVGPSGSGKTTLNSRLIKDYPEIFESSVSYTSRPMRIGERDGVHYTFIS
TEEFDQMYVDDEFVEYTNYVGSKYGTARSELKRIQNLGKVPVLEIDIKGYKQLLNAKLNL
KGVFIEPPCLETLRQRLIKRGCNTEESINKRVERANQEVEESLKCHFDFRLPNENLDEAY
NSLINKLSEWYPIHKT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaagtatagaattacctatattgataattgttggtccatcaggttcagggaag
acaacattgaattctaggcttataaaagattatccagaaatatttgaatcgagtgtgagt
tatacaagtcgtccaatgcgtattggtgaacgtgatggtgtacattatacatttatatct
acagaagaatttgatcaaatgtatgtagatgatgaatttgtagaatatacaaactatgta
ggatctaaatatggtacagcacgttcagaattaaagcgtatacaaaatttgggtaaagtc
ccagtattagaaattgatattaaaggatataaacaattattaaatgctaaattaaattta
aaaggtgtatttattgaaccaccatgtctagaaactttaagacaacgattaattaagaga
ggttgtaatactgaagaatccattaataaacgtgttgaacgagctaatcaagaagtcgaa
gaatctttgaaatgtcattttgacttcagattaccaaatgaaaatcttgatgaagcttat
aattctttaattaataaattatctgaatggtatccaatccataaaacataa

DBGET integrated database retrieval system