KEGG   Theileria annulata: TA13945Help
Entry
TA13945           CDS       T00253                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tan  Theileria annulata
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TA13945
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TA13945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 196 aa AA seqDB search
MLESIELPILIIVGPSGSGKTTLNSRLIKDYPEIFESSVSYTSRPMRIGERDGVHYTFIS
TEEFDQMYVDDEFVEYTNYVGSKYGTARSELKRIQNLGKVPVLEIDIKGYKQLLNAKLNL
KGVFIEPPCLETLRQRLIKRGCNTEESINKRVERANQEVEESLKCHFDFRLPNENLDEAY
NSLINKLSEWYPIHKT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaagtatagaattacctatattgataattgttggtccatcaggttcagggaag
acaacattgaattctaggcttataaaagattatccagaaatatttgaatcgagtgtgagt
tatacaagtcgtccaatgcgtattggtgaacgtgatggtgtacattatacatttatatct
acagaagaatttgatcaaatgtatgtagatgatgaatttgtagaatatacaaactatgta
ggatctaaatatggtacagcacgttcagaattaaagcgtatacaaaatttgggtaaagtc
ccagtattagaaattgatattaaaggatataaacaattattaaatgctaaattaaattta
aaaggtgtatttattgaaccaccatgtctagaaactttaagacaacgattaattaagaga
ggttgtaatactgaagaatccattaataaacgtgttgaacgagctaatcaagaagtcgaa
gaatctttgaaatgtcattttgacttcagattaccaaatgaaaatcttgatgaagcttat
aattctttaattaataaattatctgaatggtatccaatccataaaacataa

DBGET integrated database retrieval system