KEGG   Theileria annulata: TA14090Help
Entry
TA14090           CDS       T00253                                 

Definition
T. parva transmembrane protein 17 homologue (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TA14090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 151 aa AA seqDB search
MAPAWESLAKTLKGQVNVADVDVTRNLNLGKRFQIRGYPTLLLFHKGKMYQYEGGERTVE
KLSEFALGEFKNVTGVPVPQPLSLFALVSDFMVSGVNEALRVYDAALAGFVTISSFSFLF
GLLVGLMLSLFLFTRRATRKPKVLTERKKDK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggccccagcctgggagtcgctggccaagaccttaaaaggtcaggtgaacgtcgctgac
gttgacgttacccgaaatcttaaccttggaaagaggttccagattcgtggatatcccacg
cttctgctcttccacaagggcaaaatgtatcaatatgaaggtggtgaacgtactgtcgag
aaactatcagaattcgctctaggcgaatttaagaatgtcactggagtccctgtgccacag
ccattgtcattattcgctttggtgagcgactttatggtgagtggtgtgaatgaggctctg
agagtgtatgacgctgcacttgcaggttttgtcacgatctcctcattctcgttcctcttt
ggactccttgttggactcatgctttcgctctttttattcaccagaagagccacacgtaaa
cctaaagtcctgactgagcgcaaaaaagataaataa

DBGET integrated database retrieval system