KEGG   Theileria annulata: TA14090Help
Entry
TA14090           CDS       T00253                                 

Definition
(RefSeq) T. parva transmembrane protein 17 homologue, putative
Organism
tan  Theileria annulata
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 ERp29_N HyaE DUF5017
Motif
Other DBs
NCBI-GeneID: 3861596
NCBI-ProteinID: XP_952114
GeneDB: TA14090
UniProt: Q4UEV7
Position
2
AA seq 151 aa AA seqDB search
MAPAWESLAKTLKGQVNVADVDVTRNLNLGKRFQIRGYPTLLLFHKGKMYQYEGGERTVE
KLSEFALGEFKNVTGVPVPQPLSLFALVSDFMVSGVNEALRVYDAALAGFVTISSFSFLF
GLLVGLMLSLFLFTRRATRKPKVLTERKKDK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggccccagcctgggagtcgctggccaagaccttaaaaggtcaggtgaacgtcgctgac
gttgacgttacccgaaatcttaaccttggaaagaggttccagattcgtggatatcccacg
cttctgctcttccacaagggcaaaatgtatcaatatgaaggtggtgaacgtactgtcgag
aaactatcagaattcgctctaggcgaatttaagaatgtcactggagtccctgtgccacag
ccattgtcattattcgctttggtgagcgactttatggtgagtggtgtgaatgaggctctg
agagtgtatgacgctgcacttgcaggttttgtcacgatctcctcattctcgttcctcttt
ggactccttgttggactcatgctttcgctctttttattcaccagaagagccacacgtaaa
cctaaagtcctgactgagcgcaaaaaagataaataa

DBGET integrated database retrieval system