KEGG   Theileria annulata: TA14290Help
Entry
TA14290           CDS       T00253                                 

Definition
1-deoxy-D-xylulose 5-phosphate reducto-isomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tan  Theileria annulata
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TA14290
Enzymes [BR:tan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TA14290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 442 aa AA seqDB search
MKSTLYSTFLIIFLLSNSYSFFFKTKNTPLKVFSGPIKVAIMGSTGSVGTQALEVIRNLN
NLEGGSEPKFKVVALAAKSNHKLLSQQVNEFKPQVCHILKNYEKLPNLLKRKCEILSDKS
DLLDLCRKLDYDLIIMAISGCDGIEPTMAAAESGKKIALSNKESVVSAGSLLSKVVKKYK
TTVIPVDSEHNAIFQCLDDGQVDTTRITYVTSISSQVLAGVKNLILTTSGGPFLGKKYPE
YKNLKTSDNISHPVWKMGSKITVDSSTMMNKALEVLEAHHLFGIHLDNIKILVHKECLVH
SLVEFVDNSVLCQMYLPDMKLPISHSLNWPNRTKNSLLPLDLRGKALTFKEADFENFPFL
CLGYEVGRMGGLYPAVFNAANDVANDLFRSNMIDYDQLYHIVRETVEEFNNPDLNDDSLQ
DIMYADSWAKETANKVYSRVVT
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgactttatatagcacatttttaataatatttttattatcaaattcctactct
ttctttttcaagactaaaaatactccattaaaagtattttctggtcctattaaggtggca
attatgggctcaactggttcagttgggactcaagcactggaggttatcaggaatttgaat
aatttagaaggcggatcagagccaaaattcaaagtcgtagcactagcagcaaaaagcaac
cataaattgttatcccaacaagttaacgagttcaagccccaagtatgccatattttaaaa
aactatgaaaagttgcctaatttgttgaaaaggaagtgtgaaattttaagcgataaatca
gatttgctggatttatgcagaaaattggattatgacctaattataatggcaatttcaggg
tgcgatggaatagaaccaacaatggctgcggcagaaagtggtaaaaaaatagcactttca
aataaagaatcggtagtttctgccggaagcctcttaagcaaagtagttaagaagtataaa
acaacagtgataccagtggattcagagcacaacgcaatttttcagtgtctcgatgacggt
caagtggataccacaagaataacttatgtgactagcatatcatcgcaggtcctggctggg
gtcaagaatctaattttaacgactagtggaggaccatttctgggtaaaaaatacccagaa
tacaagaatctgaaaacttcagataatatatcgcatcctgtttggaaaatgggatctaag
ataactgtcgattcttctacaatgatgaacaaagcacttgaggttttagaagcacaccat
ctttttggaattcatttagataatattaaaatcctagttcacaaggagtgtcttgtccat
tctctagttgagttcgttgataactcagtgttatgtcaaatgtatttgcctgacatgaaa
cttcccatatcgcattccctaaattggccaaacaggaccaaaaattcgcttctaccactt
gatttaaggggcaaagctctcacgttcaaggaggctgactttgaaaacttcccattttta
tgccttggctacgaagttgggaggatgggtggcctttatcccgcagttttcaatgcagcc
aatgacgttgcaaatgatttattcaggtccaacatgatagattacgaccaactgtaccac
attgttcgtgaaactgtggaggaattcaataatcctgatctcaacgatgacagcttacag
gacataatgtacgctgattcatgggcaaaggaaactgcaaataaagtgtattctagggtc
gtcacttga

DBGET integrated database retrieval system