KEGG   Theileria annulata: TA14405Help
Entry
TA14405           CDS       T00253                                 

Definition
choline/ethanolamine kinase (EC:2.7.1.32)
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
tan  Theileria annulata
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TA14405
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     TA14405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 385 aa AA seqDB search
MEHLTVVSEHDFQHKDPVKTPENEGYFLNEKETNEVKSLCIRHVPFWNNIAKEKIDLKIV
SGALTNRVYQATLVDGDKDRYPIKSVCIKKSSTYNSLVIDDDLQYRIAKLLGDNNFGPRI
IGRFGDFTIQEWVEGNTMGIDSFQNLSVLTGIASSLAKFHKKVTELVPKEWDRTPMFLTK
IATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTSNSITNSILFCHNDLFSLN
ILDFNQGIYFIDFDFAGFNYVGWEIANFFVEVTILYDPPKPPYFISSEEYNLSEEMKTIF
ISVYLSQLLGQNVLPSDDLVNDFLQSLEIHTLGVNLFWTYWGIVMSDKPKNELSKPVKLE
AYAMFQYNLFRNNIRRLTDNKIVNT
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagcatttaaccgttgtttcagagcacgactttcagcataaggatccagtaaaaaca
ccagaaaatgagggttattttcttaatgaaaaggaaacgaatgaggttaagagtctctgt
atccggcatgttccattttggaacaatatcgcaaaggaaaaaattgatctcaagattgta
tctggtgctctaaccaatcgtgtataccaggcgacattagtcgatggagataaagataga
tatcccataaagtcagtatgtattaaaaaatcatcgacatataattcgctagtgattgat
gatgatttacagtatcgtattgcaaaattattaggtgataataatttcggacctagaata
attggtcgttttggtgattttactattcaggaatgggttgaaggaaatactatgggaatt
gattcatttcaaaatttatcagttttgactggtattgcttcatcactggcaaagttccac
aagaaagttacagagctggttccaaaggaatgggacagaactcctatgtttttaaccaaa
atagctacttggtctccacatgttgaaagaattattaaaaaatataatttggatttcgat
tataatgagttggttcagaactatgaaatgttcaaaaagatcctaaacaatcacctaaat
acatcaaattccatcacaaactcaatactattctgtcacaacgatttattttctctaaat
atccttgattttaaccaaggcatatatttcattgattttgattttgccggattcaattat
gttggatgggaaatcgccaatttctttgtagaggttacgattctttacgacccaccgaag
ccaccatacttcatttcatctgaggaatacaatttatctgaggaaatgaagactattttc
atctcagtatatctttctcaattactgggccaaaatgttttaccatctgacgatttggta
aatgattttctacagagtttagaaatacacaccttgggagtaaatttattttggacttat
tggggaatagtgatgtctgacaaaccgaaaaatgaattatctaagcctgttaaattggaa
gcttatgcgatgttccaatataatttatttaggaataatattaggaggttaactgataat
aaaattgtaaatacctaa

DBGET integrated database retrieval system