KEGG   Theileria annulata: TA14775Help
Entry
TA14775           CDS       T00253                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tan  Theileria annulata
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TA14775
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TA14775
Exosome [BR:tan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TA14775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 503 aa AA seqDB search
MDTVKVIASIDQGTQSTRCTLYDSSMNILASSKSKHTQYHPKSGWCEHDANEIMDSVYNT
MNECIRKLKEKVSNFLLVGVGVTNQRETVVVWDKDTGKPLHNAIVWLDIRAGTEANKMVE
LYGSDRHFYHINGLLISSYFSAFKLKWMSNNLDWFDKRVREESNLTGEFLTDITNASRTF
LMDINTENWSTEMLKYFRFYLKNCRIFGLTGNLLPKIRPNCSDFGTINNEKVPGFKGVKI
LGSAGDQQASCIGQGLFENLATKCTFGTGAFILTNTGSKKVMSTGGLLCTPCYKLSPTTP
TVFALEGSIAIAGAGITWLQDMGLLSDPSEISEILRKIKSSDGVVFAPAFSGLFAPRWRN
DARGSIMGMTQHTERGHIVRAYCESIGLQLYEIIHSFLSDTGLLSIPYINVDGGLSQNSE
LVQLISDLTNTRLERPENPEITSLGAGLLAGLEAKLWNDLTEVKKITNGSNKTVWEPTMS
PEQRMTIIKYWNLGIERSLSWRL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatacagtgaaagttattgcatcgattgaccagggaacccagtcaaccaggtgtact
ctgtacgattcttccatgaacatactagcatcaagtaaatccaaacacactcaataccac
ccaaaatcagggtggtgtgaacatgacgcaaacgaaatcatggattctgtttataataca
atgaacgaatgcatacggaagctgaaagaaaaggtatcaaatttccttcttgtgggagtg
ggagtaacaaaccagagagaaacagtggtggtttgggacaaagatacaggaaaaccatta
cataacgcaatagtttggctggacattagagctggcaccgaagctaacaaaatggtcgaa
ttgtatggctcagaccgacacttctatcacataaatgggttattgataagttcatacttt
tcagcatttaaactaaagtggatgtcaaataatttggactggtttgataaaagagtaaga
gaagaatcgaacctaaccggagaattcttgacggacattacaaacgcatcaagaaccttt
ctaatggatatcaatactgaaaattggtcgacggaaatgctaaagtattttagattttat
ttaaaaaattgtagaatatttggactaacgggtaatttactacctaaaataagaccaaat
tgttctgattttggtactattaacaatgaaaaggtaccaggatttaagggagttaagata
ctggggtcagcaggagatcaacaagcatcctgcataggccagggactatttgaaaactta
gcaaccaaatgcacttttggaacaggagcatttatcttaacaaacacaggttcgaaaaag
gttatgtcaacgggtggcctgttatgcacgccatgttataaattaagtccaacaaccccg
acagtgtttgcactagagggttcaatcgcaattgcgggagccggaattacctggttacaa
gatatgggcttgttatcagacccttcagagatctcagaaatattgagaaaaatcaagtca
tcagacggagtggtcttcgcaccagcgtttagtggtttgttcgccccaagatggagaaat
gatgcgagaggaagcataatgggaatgacacaacacactgaacgtggccatattgtaaga
gcatactgtgaaagcattggactacaactttacgagattatacattcatttctctcagat
acaggtctactatcaatcccatacattaatgtggatggagggctgagtcagaattcagaa
ctggttcaactcatatcagatttaactaacacgagactagaaagaccagaaaaccctgaa
attacatcacttggggcaggtctgttggcaggattggaagccaaattgtggaatgacttg
acggaagttaaaaaaataacaaatggatcaaacaaaacagtttgggaacctacaatgtca
cctgagcaaagaatgacgatcattaagtactggaacttgggaattgaaaggtcactatca
tggcgtttataa

DBGET integrated database retrieval system