KEGG   Theileria annulata: TA14790Help
Entry
TA14790           CDS       T00253                                 

Definition
camp-dependent protein kinase, beta-catalytic subunit (EC:2.7.1.37)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TA14790
Protein kinases [BR:tan01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   TA14790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 471 aa AA seqDB search
MYSINEVRTSSNCKSCLKTKTSMNSIVSDTQCNNGFNNIGCKSNVSSSSKGITKCNVKVL
KRFLNYQRSNTADSSSYNRLNNLGACSGELKQENSYRHYPTFKDKQTLFNNCKRNDFEIG
KTIGTGSYATVCIAKYTPNNRYFELTRYLYPNFRERGSVDSAYTAYSGLSSGQEYYNNQV
HDTETKEKIVSLKILSKDKIIEKRQLEHVKNEKNILSSLKHPFIVEYLGSFQDPLNLYFV
LEFVPGGELFTYLRRMRNFPLEYTRFYSSQVLLALDYLHMNKLVYRDLKPENILLDVMGY
IRIVDFGFAKRLDKGRTYTVCGTCDYLAPEIFLKKGHDFMADFYSFGVFLYELLIGIPPF
YANTPQKTYKLALNNEVKFSRKISEPSRDIIRKLLQVEPSKRLGNDVREVYFHPFFEGID
FNMLLAKRIKAPIVPTVSGQDDVSNFIKYPESWDQYKNEVTKEQQQLFQFF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtattaatgaagtaaggacaagcagtaactgtaaaagctgtctgaaaacgaaa
acaagtatgaatagcatagtgagtgatacgcaatgtaataatggttttaataacattggt
tgtaaaagtaatgttagtagtagtagcaaaggcataaccaaatgcaatgttaaggttttg
aaaagattcttaaattaccaacgcagtaacacagcagattcttcaagttataaccgactt
aataatttaggggcatgttcgggagaattgaagcaagaaaattcttacagacattatccc
acatttaaagataaacaaacactgtttaataattgtaaaagaaacgactttgaaattgga
aaaactataggaacaggctcctacgctacagtctgtatagccaagtacacgccgaataat
cgctactttgagctgacaagatatctgtatccgaattttagggaaaggggaagcgtggac
tctgcttacacagcttattcaggactaagttctggacaagaatactataataaccaagta
catgatacggaaaccaaagaaaagatcgtttcattgaagatattgagcaaagataaaatt
attgagaaaagacaactggagcacgtgaaaaacgaaaaaaatatcttgagctcgctcaaa
catccattcatagtagaatacctcggcagcttccaggacccattaaacctatatttcgtg
cttgaattcgttccaggtggagaactttttacgtacctaagaaggatgcgcaactttcca
ctggaatacacacgcttctattcgtcacaagtgctacttgcacttgactacttgcacatg
aataagctggtataccgggacttgaagcctgagaacattcttctagacgttatgggctac
attcgaattgttgatttcggatttgcaaagagacttgataaaggcagaacatatacagtg
tgtggaacatgcgattatttggctccagagattttcctaaagaagggtcatgattttatg
gccgatttctactcattcggggtctttctgtacgaactcctgattggaattccccctttc
tatgcaaatacgcctcaaaaaacatataaactggcgctgaataatgaagtcaagtttagt
agaaagatcagtgaacctagtcgagatatcataaggaaattgctgcaggtcgaaccctct
aaaaggctagggaacgacgtcagggaagtttacttccaccccttcttcgagggaatcgac
ttcaacatgctgttggcaaagcggataaaggcgccgatcgtaccgaccgtcagcgggcag
gacgacgtgagtaattttataaagtacccagagtcttgggaccagtacaaaaatgaagtt
acgaaggagcaacagcaacttttccagtttttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system