KEGG   Theileria annulata: TA14820Help
Entry
TA14820           CDS       T00253                                 

Definition
initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
tan  Theileria annulata
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TA14820
Messenger RNA biogenesis [BR:tan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     TA14820
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     TA14820
Translation factors [BR:tan03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TA14820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 237 aa AA seqDB search
MAESASVAVNGTKKCPSLTFNKNTEDHAKLSELFESTTINLDTPLSLKNKWVIWEQIVKM
PEHSQNDYKEHTKPLVSFDSVQAFWNLWFNIPQPSELATNKRLARECSDGSEHFVDAIMV
FRDGVQPMWEDPLNKDGGHFDYRFRPTDVQQLTVDEYWNNIILGLVGSTIPLCEFINGVR
LVDKLSSRFPVLRIEVWFKNLGEANDPTQLMKSVGSCMARKLDGSVGTIPKGDLKWH
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtcagctagtgttgctgttaatggcacaaaaaagtgtccgtctttaactttt
aacaagaatacagaagaccatgctaaattatcagaattatttgaatcgacaacaataaac
cttgatactcccctgtctttgaagaataaatgggtgatatgggaacagatagtaaagatg
ccagaacactcccaaaatgattataaagaacacacaaaaccattggtttcatttgattct
gtacaggccttttggaatttgtggtttaatattccacaacccagtgaattggctaccaat
aaaagattggcccgtgagtgttccgacggttctgagcattttgttgacgccattatggtg
ttcagggacggagtgcaaccaatgtgggaagatccgttgaataaggatggaggacacttc
gattaccgtttcagaccaacagatgtacaacaactcacagtggatgaatactggaataac
attattttgggacttgtaggatcaaccattccactttgcgagtttattaatggagttaga
ttagtggacaaactcagctcacgtttcccagtcctcagaatagaagtctggttcaaaaat
ttgggagaagcaaatgatcctacacaactcatgaaatctgtaggctcatgtatggcacga
aaacttgacggtagtgttggaacaatacctaagggtgatttaaaatggcattaa

DBGET integrated database retrieval system