KEGG   Theileria annulata: TA14820Help
Entry
TA14820           CDS       T00253                                 

Definition
(RefSeq) initiation factor 4E, putative
  KO
K03259  
translation initiation factor 4E
Organism
tan  Theileria annulata
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TA14820
Messenger RNA biogenesis [BR:tan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     TA14820
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     TA14820
Translation factors [BR:tan03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TA14820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
2
AA seq 237 aa AA seqDB search
MAESASVAVNGTKKCPSLTFNKNTEDHAKLSELFESTTINLDTPLSLKNKWVIWEQIVKM
PEHSQNDYKEHTKPLVSFDSVQAFWNLWFNIPQPSELATNKRLARECSDGSEHFVDAIMV
FRDGVQPMWEDPLNKDGGHFDYRFRPTDVQQLTVDEYWNNIILGLVGSTIPLCEFINGVR
LVDKLSSRFPVLRIEVWFKNLGEANDPTQLMKSVGSCMARKLDGSVGTIPKGDLKWH
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtcagctagtgttgctgttaatggcacaaaaaagtgtccgtctttaactttt
aacaagaatacagaagaccatgctaaattatcagaattatttgaatcgacaacaataaac
cttgatactcccctgtctttgaagaataaatgggtgatatgggaacagatagtaaagatg
ccagaacactcccaaaatgattataaagaacacacaaaaccattggtttcatttgattct
gtacaggccttttggaatttgtggtttaatattccacaacccagtgaattggctaccaat
aaaagattggcccgtgagtgttccgacggttctgagcattttgttgacgccattatggtg
ttcagggacggagtgcaaccaatgtgggaagatccgttgaataaggatggaggacacttc
gattaccgtttcagaccaacagatgtacaacaactcacagtggatgaatactggaataac
attattttgggacttgtaggatcaaccattccactttgcgagtttattaatggagttaga
ttagtggacaaactcagctcacgtttcccagtcctcagaatagaagtctggttcaaaaat
ttgggagaagcaaatgatcctacacaactcatgaaatctgtaggctcatgtatggcacga
aaacttgacggtagtgttggaacaatacctaagggtgatttaaaatggcattaa

DBGET integrated database retrieval system