KEGG   Theileria annulata: TA16070Help
Entry
TA16070           CDS       T00253                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TA16070
Peptidases [BR:tan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TA16070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2
AA seq 382 aa AA seqDB search
MGFFTDSGSSKHSEISSRSSSPSNDNSNLENRNIMYMLKNCLILSKDGNKKSICDEGVKF
NGLENNLNNCYSNVVIQSLYSYHEFRNRMIKMKKSGGSISSELAKLYSKCVSQSDIQSTK
GFLKKVCSTKDDFILGDQQDAHEFLTYILNAMIDEIRNIEDEYVKPKTFMSSKSGGKRKL
EKRTWLNELVEGCVKSETRCHECDSVTGMTEPFITLSLNIFDNCDINLCLQRYCDDELLS
GKNQFFCEKCDKYCDASKRIVFDLMPPLLILHLKRFKYTTKPGSSLCSVYERLPYSVVCS
NVIQVNCKRHPCPIVYELFSIISHIGTSPDYGHYINISELGGSWFRCDDASILKLDDYHS
EIGDETTSGNDASYILFYRIKE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggattttttactgatagtggctcgtccaaacattcagaaatttcgtcaagatcatca
tcgccatctaatgacaattctaacctagaaaatagaaatataatgtatatgctgaagaat
tgtttaattctttccaaagatggtaataagaaatctatatgtgatgaaggtgtcaaattc
aatggattagaaaacaatttaaataattgttattctaacgtagtaatacaatccctatat
tcttatcatgaattcagaaatcgaatgataaaaatgaaaaaatcaggcggttcgatttcg
tcagagcttgctaaactatatagtaaatgtgtttctcaatctgatattcaatctaccaaa
ggatttttgaaaaaagtatgtagtacaaaagatgatttcatactcggggaccagcaagat
gcacacgaattcttgacttatatattgaatgcaatgatagatgaaatcagaaatattgaa
gacgagtacgtaaaacctaaaacatttatgagctccaaaagtggagggaaaagaaaattg
gaaaagagaacatggttgaatgagttagtagaaggatgtgtaaaatctgaaacaagatgt
catgaatgcgatagcgttacaggtatgacggaaccgttcataacactctcactcaacatt
ttcgataactgtgatatcaacctttgtttacagcgttattgcgatgatgaacttctctct
ggtaaaaaccagttcttttgtgagaagtgtgataagtattgtgacgcgtcgaagagaata
gtctttgaccttatgccacctttattaatcctgcacctaaagaggttcaaatataccact
aaaccaggaagttccctttgttcagtatacgaaagacttccatattcagtagtgtgttct
aacgttattcaggtaaactgtaaacggcacccatgtcccatcgtttatgaactattctca
attatctctcacatcggaacttcccccgattatggacattatataaacatttctgaactt
ggaggaagttggtttagatgtgatgatgcttccatattaaaactcgacgattatcactct
gaaatcggagatgaaaccacctcggggaacgacgccagttatatcctgttttatcgcatc
aaagaataa

DBGET integrated database retrieval system