KEGG   Theileria annulata: TA16710Help
Entry
TA16710           CDS       T00253                                 

Definition
TFIIH subunit, Tf2b
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tan  Theileria annulata
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tan00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TA16710
  Replication and repair
   03420 Nucleotide excision repair
    TA16710
Transcription machinery [BR:tan03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TA16710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 645 aa AA seqDB search
MSEVLENDQTEEEESEAQSIIEENFFNYLKELDEQVWERLFRVKACLVALFRSLGELEKL
IIFRLLYIDQSISEKPLRLWMRAHSIADLKHSLTLLQSYKIITVLENTTNDEKQQYKLND
GFKNGFVTLLSDDSSYKYSYELVKLESILVSSTKTKEPTKNSNNSYHDTVTEDHVSKTAE
KAVENTTEELTEETPRNKNKSLITLDDLVKHAKLKLDFILLFLVSPEARKGTMLVNKILR
KIKRLKKQSDETKNDKKIENLEAKFNRLSKNSGVISQDLLQILRRFGMVDPAKKNYKSSK
TVGTKMSRQTLSWLLKDVTSQMTSLLVGHLQNLDNGYLTNCKSMNRSSEDSKKSSLELKE
ASMKTVTESVELLLSLSQASCGDCFSTEGLTKTQIRLLRLLNELGIVYYKNPKKFYLYDL
SYIVGKTNTNSVLPNSKDLDISIKAGNDSRIIVQSNFKVYVYTASPLQISVLSHLCELQA
RTPNLVVGVLTRESVQSAFKSGITSKEIIRFLSPNGMNSSIGSQENTLLNSSFTYSIPEN
VCRQLKMWESERDRIELCPSIVFKRWDQDFMPDLFQRTVRWAQSKRYELFYTQWPSDPHS
PEYHEWISKEKYLACNLEFKEEVINQIRLIRADISAERQAKISSG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagttctcgaaaatgaccaaacagaagaagaagaatctgaagctcagtcaata
attgaagagaatttttttaattatctcaaagaattagatgaacaagtatgggaaagatta
tttcgagttaaagcatgcctagtagcactgtttagaagtctaggagaattggaaaagtta
attatattcagattattgtacattgaccagtcaataagcgaaaagccactcagactatgg
atgcgtgcccactcaatagcagacttgaagcactcacttacattattacaatcatacaaa
attattacagtgttagaaaacacgacaaatgacgaaaaacaacagtataagctcaatgat
ggttttaaaaatggattcgtgacactcctatcagatgattctagttataaatattcatac
gagttagttaaacttgaatctattttggtttcatcaacaaaaacaaaagaaccgaccaaa
aattctaacaattcatatcatgatactgtcacagaagatcacgtaagtaaaacggcagaa
aaggctgttgaaaatacgactgaagaattgactgaagaaacgcctaggaacaagaataaa
agtcttattacgctggatgacctggtgaaacacgcgaaactaaagttggactttatcctg
ctatttcttgtatcaccagaagcgagaaaaggcacgatgctggttaacaagatattgagg
aaaatcaaaagactgaagaaacagtcagatgaaaccaaaaacgataaaaaaatcgaaaat
ttagaagccaagtttaataggctctcgaaaaattcaggtgtaataagtcaggatttatta
cagatattgaggaggtttggaatggtagacccagcgaagaagaattacaaaagctccaag
acagtaggaacgaagatgagtagacagacattgagttggttattgaaggacgtgacaagt
cagatgacgtcactgttggttggtcatttgcagaacctggataacgggtacctgacaaac
tgtaagtcaatgaataggagctcagaggactctaaaaaatcatctttggagttaaaggaa
gcgtccatgaagacagtaacagaatcagttgaacttttattgtcactgtcccaagctagt
tgtggagattgtttctcaacagagggattaacaaagacccaaatcagactgttaagactt
ctaaacgaactgggaatagtttattacaagaaccctaaaaagttctatttgtacgattta
tcatatatcgtgggaaaaacaaacacaaacagtgttctgcccaatagcaaggaccttgat
ataagtataaaggcaggtaacgacagtagaatcatagtacagagtaatttcaaagtgtat
gtgtatacagcaagcccactgcaaatcagtgttttgagtcatttgtgtgaacttcaagca
agaacaccaaatctggttgtaggagttttaactagagagagtgtacagtcagcatttaag
tcgggaattacctcaaaagagattatcagattcttgtcaccaaatggtatgaattcatca
attggaagccaggaaaatacgttacttaattcatcattcacctacagcataccagaaaat
gtgtgcagacaactcaaaatgtgggagtctgaaagggatagaatagagttatgtccatca
atagtgttcaaaaggtgggaccaagattttatgcctgatctttttcagagaacagtaagg
tgggctcagagtaagaggtatgaactcttttacacacagtggccatcagatccgcactcg
ccagagtaccacgagtggatatccaaggaaaagtatctagcatgtaaccttgagtttaaa
gaagaagtaattaatcagattaggttaattcgagctgacatttcagcagaaagacaggcc
aaaattagtagtggatag

DBGET integrated database retrieval system