KEGG   Theileria annulata: TA19010Help
Entry
TA19010           CDS       T00253                                 

Definition
protein disulfide isomerase precursor (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TA19010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 524 aa AA seqDB search
MTKFINCKVIIITLLIVIKLYIKPILAGLVLEVPEVAQSDFDDYVKKTNRIPVVLNYPTL
FIFSTGAINDFRNVSTLLSHDEKCEFVTVESATPFDGNITSLEPVMTYVKDGQTKKYDGP
INPGYIMSWLSNQRVCEMRVKDLSNFKALQKSLPSGHVQVMILFGEGQNDPEVVETVRSF
ISEKELAVPVLYVPDQALSDQIAKSLNQDQIKYPTVLVSRNTTLLPKTSFYTNDMRNKKE
LYEFLKEELIPPIHSTNSYMLPMFLVMKKTIIYIFTKEKELKKYLSESWINTVPRKHSEK
LVFLHSKGSELVENKMNTILAIDSEYEEIVVRAFVINLDTLEFYKFKPLTIEDGTISEEG
MNKFIDDLENGRLSHYVKSELPIPENIDKGPVKTIVGEDFHRRVIESKDDILVLFLSSWC
GHCHKAKRLFRDMGRRLKGSNGPILATFDAYNNEVEDMEISQFPTIALFQSGNKTDPLFY
NGPDTLEDISMFLESNCKHNKVSAENILQKHVSQETIFEYHTEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagttcatcaactgtaaagttataataatcaccctcctaatcgtgattaaactt
tacattaaacccattttggcaggacttgttctggaagtacccgaggtcgcacagtcagat
tttgatgattatgtaaagaaaacaaatagaataccagttgttttaaattatccaacactc
ttcatattttcaactggagccattaatgatttcaggaatgtttcaacacttctatctcat
gacgaaaagtgtgaattcgtaaccgttgaatcggcaacgccattcgatggaaatataaca
tcactggagccagtaatgacgtatgttaaagacggacagacaaagaaatacgacggacca
ataaaccctgggtatatcatgagttggctgagtaaccagagagtctgtgaaatgagagtc
aaggatctctcgaatttcaaagcacttcaaaagtcgctgccatcaggacatgtacaagta
atgatcttgtttggagaaggacaaaacgacccggaagttgtggaaacagtcagatcattc
atttcagaaaaggaactcgcagtcccagttttatacgtaccagatcaagctctctcagat
caaattgctaaatcactcaatcaagaccaaataaaatatccaaccgtattggtatcaaga
aacacgacactgttaccaaaaacctcgttctacaccaacgatatgagaaataagaaggag
ctttacgagtttttgaaggaagaactgatcccgccgatccattcaactaactcgtacatg
ctcccgatgttcctggttatgaagaagacgataatatacatatttactaaggaaaaagaa
cttaaaaagtacctgagcgaatcctggataaacacagtccctagaaaacatagcgaaaaa
ctggtctttctccactctaagggctcagaactggtggaaaataaaatgaacacaatactg
gcaattgactctgaatacgaggaaatagtcgttagagcatttgtaattaaccttgatacg
ctagaattttacaaattcaagcccttgacaatagaagatggaacaatatcagaggaggga
atgaataagtttattgatgacttggagaatggtagattaagccattatgtaaagagtgaa
cttccgataccagaaaacatcgataagggtccagttaaaacgattgtgggcgaagatttc
cacagaagagtcattgagtccaaggacgatattcttgtgctgttcctctcatcatggtgt
ggacactgccataaagcaaagagactttttagggatatgggaagaaggctgaaagggtca
aatgggccgattttggcaacgtttgacgcctataacaacgaagtcgaagatatggaaatc
agccaattcccaacaatagcgctatttcaaagcggtaataaaaccgacccattgttttat
aacggaccagatacccttgaagatatctcaatgttcttggaaagtaactgcaaacacaac
aaagtgagcgcagaaaacattctgcagaagcatgtttcacaggaaacaatcttcgaatac
catacagaactctaa

DBGET integrated database retrieval system