KEGG   Theileria annulata: TA19055Help
Entry
TA19055           CDS       T00253                                 

Definition
SONA
Orthology
K14298  
mRNA export factor
Organism
tan  Theileria annulata
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TA19055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 346 aa AA seqDB search
MSFSRTTFDDQPQKFMLNNLPNDSISHLRWSTTTNPLLLTAGSWDKTLRIWKINTGLGNA
INTDMVCSFKQDAPVLCSAFSADSMRLFGGGCTNNVLTYDLNNPSGAGVIIARHQKPVNG
VHWIPQFNLLLSTSWDGFVNLWDGRQEQPVWSENLNSKVFASDVKDNIMCVADSNRKLNV
WSLEKLQHSNSKITIDSSLKLQIRALSLFPDTKVRSGVAYSSIGGRCVVNYFTEDEKKNN
FSFKCHRQDQPGKGTFTYSVNAIDFHTVYGTFVSGGGDGTFTIWDKDNKSRVKAFSNVGA
PVVDVKFMSEGNLLAYATSYDWYKGLNHSLISNTNKSIGIIKVLFA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttcacgcacaacctttgatgaccagcctcaaaagtttatgcttaataatcta
ccaaacgattccatttcacatctaagatggagtacgacaacaaacccgttgctactgacg
gcagggagttgggacaagacgcttaggatttggaaaattaacacaggtcttggtaacgca
attaatacagacatggtgtgcagcttcaaacaggatgcacctgtactatgttcagccttc
tctgcagattcaatgcgtttattcggaggaggatgtactaataatgtgttaacatacgat
ttaaataatccaagcggtgcaggagttatcatagcaagacatcagaagccggttaatgga
gttcattggatcccacagttcaacctcctgttatctacaagttgggacggatttgtgaac
ttgtgggatggaagacaagaacagccggtgtggtcagagaacctaaactctaaagttttt
gcatctgatgttaaggataatataatgtgtgtagcagacagtaaccgcaaacttaatgtc
tggagcctcgagaaactacaacattccaacagtaaaataactatcgactccagtttaaag
ctacaaatcagagcactatcgctatttccagatacaaaagtgcggtcaggggttgcatac
agttcaattggcggtcgctgcgtagtaaactatttcacagaagacgaaaagaagaataac
ttctcattcaagtgtcatagacaagaccagcctggcaaaggcacgttcacctactcagta
aacgcaattgatttccatacagtgtacggcactttcgtctcaggaggaggagatggtaca
ttcaccatctgggataaggataacaagtcaagagttaaggcctttagtaacgtaggagcg
cctgtggtggacgtcaagttcatgtcagaaggtaacctcctggcctatgccacaagctac
gactggtataaaggccttaaccactcactaatatcaaacactaataaatctatcggaatc
atcaaggtactttttgcgtag

DBGET integrated database retrieval system