KEGG   Theileria annulata: TA19110Help
Entry
TA19110           CDS       T00253                                 

Definition
serine-threonine protein kinase (EC:2.7.1.-)
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TA19110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 560 aa AA seqDB search
MTHDGDENKMYDNEKFNSDDGYYRKRDSSRINDRRRPSRRRYSSRHMYHSSNYRHKRHKH
SRHKSYSSTPSYSRSLTHNTPEHSNSIGRTRSKSSKTDRESYSGSDSDRNHRRYSRSSSV
NRRRYRNHNKYRHRDRYRDRDRRYSRRSHRPSRRRKYRRSYTLSYRTKYSHRDKYINRHR
YSNRDKYTDRAKSPKDEIIHFKWDKGMNLSEYVVLNKVSDGTFGRVLLCEKAGKQFAVKV
VRDVDKYTQSAKIEADILLDIKNSDVNSESHCVILHDNFMYRNRNMCLVFEKLGPSLYEF
LEKNDFKGFFISDIQNMAYQLLKGLSFLKKKRLVHTDIKPENILLVCGKDDFIEVPFPRS
HTGMMTKRPAMSDIKLIDFGSAIYEDEYHSSIINTRQYRAPEVILGNNLYLSFMLNEIRV
TICVDIGWSYSSDLWSLGCTLMELYTGHLLFRTHSHMEHLAMMEKTIGKFPQEVISSAKN
TQGKNYINRDEPRLDWPEGSKSKSSVHRVEECKTIMELVKPEHRLFGEFIRYILNLDSNK
RPTPEEAMQHEFFTLKLPEN
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgactcacgacggtgacgaaaataaaatgtatgataatgaaaaatttaattccgatgat
ggatattatcgcaaaagagattccagtagaataaatgaccgtagaaggccaagccgtaga
agatatagtagccgccatatgtatcattcctctaattatagacataaacgacataaacac
tccagacataaaagttattccagtaccccttcctatagtagaagtttaactcataataca
cctgaacacagtaattctattggcagaacccgtagtaaaagtagcaaaactgaccgagaa
agttatagcggaagcgatagcgatcgaaaccatagaagatattcgagaagttcaagcgta
aatcgccgtcgctatagaaaccataataaatataggcatcgagatcgatatagagatcga
gatagaagatatagcagaagatcacatagacccagtagaagaagaaaatatagacgcagt
tacaccctctcatataggactaaatactcccatcgagataaatatatcaataggcataga
tatagtaatagagataagtatactgatagagccaagtcacccaaagatgaaataatccat
ttcaagtgggacaagggtatgaatttatcagagtacgtagtcttgaataaagtgagcgat
ggaacatttggcagagttttattatgtgaaaaggcaggtaaacagtttgcagtcaaggtc
gtgagagatgttgataaatacacccaatcagcaaagatcgaagcagatatacttctggat
ataaagaactcggatgtaaattccgaaagtcattgcgttatattacatgacaactttatg
tataggaatagaaatatgtgcttagtttttgagaaacttggaccttcactatacgaattt
ttggaaaaaaacgattttaaagggttttttatctcagacatacaaaatatggcatatcaa
ctactgaaaggactgtcatttcttaagaaaaaacgtctcgttcacacggatattaagcct
gaaaacatactactagtatgtggaaaagacgacttcatagaagtcccgttcccaagatcg
catactggaatgatgactaaaagaccggcaatgtcagatattaaactcattgactttgga
agcgctatctacgaggatgaatatcacagctcaattattaacactagacaatacagagcc
ccggaagttattctaggtaataatttatatcttagttttatgttgaatgaaattagagtg
acgatttgtgtagatatcggatggagctactcgagtgatttgtggtcactaggatgtaca
ttaatggagttgtacacaggacatttgctctttagaacacatagccatatggaacaccta
gcaatgatggaaaaaactatcggtaaattcccacaagaagttataagttccgcaaaaaat
actcaaggaaaaaactatattaatcgcgatgaacccagactagactggccggaaggatca
aaatcaaagtcatcagtccatagagttgaggagtgcaaaaccataatggaattggtgaag
cctgaacacagactctttggagaatttatcagatatatactgaacttggactcgaataaa
agaccaacaccggaagaggcaatgcagcatgaattctttacccttaaattaccagaaaat
taa

DBGET integrated database retrieval system