KEGG   Theileria annulata: TA19690Help
Entry
TA19690           CDS       T00253                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tan  Theileria annulata
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TA19690
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TA19690
  Amino acid metabolism
   00310 Lysine degradation
    TA19690
Enzymes [BR:tan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TA19690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 457 aa AA seqDB search
MTYNIRFCLRFHRYFNRFALNKNSSRFYSVLPTCKSTLTEPSDRYAKSFVSSKGSDFNPL
KLIGNRYFSKDIKVINVPTLGDSISEGTLTKWAVSVGDYLNVDDLIAVVETDKVSVDVNS
PFSGVLTKTFSNTGDTILVGKPLVEIDLAGKPSEKAPEKKPDAKPPASTPTKPETKSPEP
PKPADSKPVSSFEVKTPPTPVESKPLPQFEKGSPLSMVPPTPVPSSDLEPETRVPLTRMR
MRIAERLKLAQTENVMLTTFNECDMSELTKVRKMLNESGEVSCKLGFVSAFMRASTLALL
KMPIMNSYIDGKEMVTKNYVDISVAVATPTGLLVPVIRNCEFKNWEELELSLLEMAKKAR
DGSITIEDMTGGTFTISNGGVYGSLLSTPIINPPQSSILGMHAITKRAVVRDDNIVIRPV
MNVALTYDHRLIDGRDAVTFLNTIKKFIENPSLLLLK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaatattagattctgtcttcgttttcatagatattttaatcgttttgcccta
aataaaaattcttctagattttattctgtccttccaacttgtaaatccaccttaacagaa
cctagtgacagatatgctaaatctttcgtatcctctaaaggttctgattttaatcctctg
aagcttataggtaatcgttatttttcaaaagatatcaaggttattaatgtccctaccttg
ggcgattctattagcgagggtactctaaccaagtgggccgtttcagttggagattattta
aacgtagatgatctaatagccgtagtagagaccgacaaggtctcagttgatgtcaactcg
cccttttcaggagttctcaccaagacgttttcaaatacaggagatacaatcctggttgga
aaaccactcgttgaaattgacttggccggtaaaccttcagaaaaggctccagaaaagaag
cccgatgctaaaccaccggcttcgactcctactaaacctgagacaaaatctcctgaaccg
cctaaacctgcagattcaaagccagtatcttcatttgaagtcaaaacaccccccactccc
gtggaatcgaaaccacttcctcaatttgaaaagggctctcctttgagcatggttccacca
actccagtaccatcttccgatttggaacctgaaactagagttcctctcaccagaatgcgc
atgaggattgcagaacgacttaagttggcccagacagagaatgttatgttgacaacattc
aacgagtgtgatatgagcgagttaacaaaggtcaggaagatgcttaatgaatcaggagaa
gtttcatgcaaacttggattcgtctctgcttttatgcgagcctcaacactagcactctta
aagatgccaatcatgaattcatatattgatgggaaagagatggtgacaaagaactacgtg
gacatttcagtcgcagttgccactcccacgggactattggtccctgttataagaaactgc
gaattcaagaattgggaagaacttgaactctcacttctggagatggctaagaaggccaga
gacggctccattaccatcgaggacatgaccggcggaactttcaccatttcgaatggcggc
gtttatggcagtctcttgagcactccaataattaaccctccccaatcttcaattctaggg
atgcatgcaatcactaaacgtgcagttgtccgcgacgacaacatagtaatcaggcctgtc
atgaacgtcgccttgacctacgaccacaggctcattgacggcagggacgctgtcactttt
ctgaacacgattaagaagtttatagagaacccatcgcttcttctgcttaagtaa

DBGET integrated database retrieval system