KEGG   Theileria annulata: TA19690Help
Entry
TA19690           CDS       T00253                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor, putative
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tan  Theileria annulata
Pathway
tan00020  Citrate cycle (TCA cycle)
tan00310  Lysine degradation
tan01100  Metabolic pathways
tan01110  Biosynthesis of secondary metabolites
tan01130  Biosynthesis of antibiotics
tan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TA19690
  Amino acid metabolism
   00310 Lysine degradation
    TA19690
Enzymes [BR:tan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TA19690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl RnfC_N
Motif
Other DBs
NCBI-GeneID: 3863864
NCBI-ProteinID: XP_954465
GeneDB: TA19690
UniProt: Q4UGK1
Position
1
AA seq 457 aa AA seqDB search
MTYNIRFCLRFHRYFNRFALNKNSSRFYSVLPTCKSTLTEPSDRYAKSFVSSKGSDFNPL
KLIGNRYFSKDIKVINVPTLGDSISEGTLTKWAVSVGDYLNVDDLIAVVETDKVSVDVNS
PFSGVLTKTFSNTGDTILVGKPLVEIDLAGKPSEKAPEKKPDAKPPASTPTKPETKSPEP
PKPADSKPVSSFEVKTPPTPVESKPLPQFEKGSPLSMVPPTPVPSSDLEPETRVPLTRMR
MRIAERLKLAQTENVMLTTFNECDMSELTKVRKMLNESGEVSCKLGFVSAFMRASTLALL
KMPIMNSYIDGKEMVTKNYVDISVAVATPTGLLVPVIRNCEFKNWEELELSLLEMAKKAR
DGSITIEDMTGGTFTISNGGVYGSLLSTPIINPPQSSILGMHAITKRAVVRDDNIVIRPV
MNVALTYDHRLIDGRDAVTFLNTIKKFIENPSLLLLK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaatattagattctgtcttcgttttcatagatattttaatcgttttgcccta
aataaaaattcttctagattttattctgtccttccaacttgtaaatccaccttaacagaa
cctagtgacagatatgctaaatctttcgtatcctctaaaggttctgattttaatcctctg
aagcttataggtaatcgttatttttcaaaagatatcaaggttattaatgtccctaccttg
ggcgattctattagcgagggtactctaaccaagtgggccgtttcagttggagattattta
aacgtagatgatctaatagccgtagtagagaccgacaaggtctcagttgatgtcaactcg
cccttttcaggagttctcaccaagacgttttcaaatacaggagatacaatcctggttgga
aaaccactcgttgaaattgacttggccggtaaaccttcagaaaaggctccagaaaagaag
cccgatgctaaaccaccggcttcgactcctactaaacctgagacaaaatctcctgaaccg
cctaaacctgcagattcaaagccagtatcttcatttgaagtcaaaacaccccccactccc
gtggaatcgaaaccacttcctcaatttgaaaagggctctcctttgagcatggttccacca
actccagtaccatcttccgatttggaacctgaaactagagttcctctcaccagaatgcgc
atgaggattgcagaacgacttaagttggcccagacagagaatgttatgttgacaacattc
aacgagtgtgatatgagcgagttaacaaaggtcaggaagatgcttaatgaatcaggagaa
gtttcatgcaaacttggattcgtctctgcttttatgcgagcctcaacactagcactctta
aagatgccaatcatgaattcatatattgatgggaaagagatggtgacaaagaactacgtg
gacatttcagtcgcagttgccactcccacgggactattggtccctgttataagaaactgc
gaattcaagaattgggaagaacttgaactctcacttctggagatggctaagaaggccaga
gacggctccattaccatcgaggacatgaccggcggaactttcaccatttcgaatggcggc
gtttatggcagtctcttgagcactccaataattaaccctccccaatcttcaattctaggg
atgcatgcaatcactaaacgtgcagttgtccgcgacgacaacatagtaatcaggcctgtc
atgaacgtcgccttgacctacgaccacaggctcattgacggcagggacgctgtcactttt
ctgaacacgattaagaagtttatagagaacccatcgcttcttctgcttaagtaa

DBGET integrated database retrieval system