KEGG   Theileria annulata: TA19865Help
Entry
TA19865           CDS       T00253                                 

Definition
surface protein d precursor (EC:3.1.2.15)
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TA19865
Peptidases [BR:tan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TA19865
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 178 aa AA seqDB search
MKLTAGLVRLYFLIFIISSSVLGNNNCKDEELDAMGMLIKQDLNKELLFQTSHILTKVGK
KHGIKPGTRVDKFLSELMKMFGQHGIGGVSEQCLNCFAASIHCVANKCKGPCLRGPCTEE
CQNCVRKNCMPALLECIGKESIPNPCDWKEDYLKYKLPKTEEKEDDESKKKGEASGGS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaccgctggattagtcaggctctactttctgattttcattattagttcctca
gtcttgggaaataataattgtaaagatgaagaactagatgctatgggtatgttgatcaaa
caggatttaaacaaagaactattgttccaaacatcacatattttgacaaaagtagggaaa
aagcatggtattaaacctggaacaagagtagacaaattcctatctgaacttatgaaaatg
ttcggtcaacacggcattggtggtgttagtgagcaatgtcttaattgttttgcggcaagc
atacactgtgttgcgaacaaatgtaaaggaccatgtcttaggggaccttgtactgaagaa
tgccaaaattgtgttagaaaaaattgcatgccagcattactggaatgtataggtaaagaa
agcattccgaatccttgtgattggaaagaagattatctaaaatacaaacttccgaaaact
gaagaaaaagaagatgatgaatctaagaaaaaaggtgaagcctcgggcggttcatag

DBGET integrated database retrieval system