KEGG   Theileria annulata: TA20650Help
Entry
TA20650           CDS       T00253                                 

Definition
aspartate transcarbamoylase (EC:2.1.3.2 6.5.1.1)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tan  Theileria annulata
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tan00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tan00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 377 aa AA seqDB search
MKHFLKHSWVALGAGVVTVTALYALSFVPWVRVSLTELGLYCCDPLLHCLDAAKRKVASS
LRNKGLLFVDDLSNAQLSCIFEVADFFRKKLNQRLNLELLAGKVMTTLFCEPSTRTRCSF
ETAMLKLGGKVVSVTDSGSSFTKGESIDDSVRVLSSYSDVLVLRHPETNVIQRVKHQCMV
PLINAGDGSGEHPTQALLDLYTINRYFPVFSSEKEITVCLVGDLKYARTTHSLVRLLSRF
NVVLRYVSTPSLQMPTQIQREVEQNFAKYNIPDLAFPRQTSFKKLSDALDNVDVIYVTRI
QKERMTPSELPSPKESFKVDKNVMSVLPKHAKVLHPLPRVEEVSLDVDSDERCVFFEQAE
NGLYVRMALLYLILNKC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatttcttaaaacattcatgggtcgcccttggggcaggagttgtcactgtaacg
gctttatatgcgctttcatttgttccctgggttcgagttagcctaactgaacttggtttg
tactgttgtgaccctctattacactgtcttgatgctgcgaagagaaaggtcgcatcttct
cttagaaataaagggttgttgttcgtggatgatttgtccaatgcccagctgagttgtatt
tttgaagtggctgactttttcaggaaaaaacttaaccagcgactaaatcttgaactcctg
gccggaaaggtcatgacaaccctcttctgcgaacccagtactaggacaagatgttcattc
gagacggcaatgctaaagttaggtggtaaggtggtttcagtgactgattctggatcatca
ttcacaaagggcgaaagcatcgatgattcagttagagttttatcgtcatacagtgacgtt
ttggtgctccgtcaccctgaaactaatgttattcaacgtgttaaacaccaatgtatggtt
cctttgattaatgcaggagatggttcaggagaacacccaactcaagcactacttgattta
tataccatcaatagatacttcccagtattctcatctgaaaaggagattacagtgtgtttg
gtaggagaccttaaatatgctaggacaactcactctcttgtaaggcttttgagtcgattt
aatgttgttttgagatacgtctcaacaccctcacttcaaatgccaactcaaattcaacgt
gaagttgaacagaactttgcaaaatacaatattcctgatttggcttttccaaggcaaact
agtttcaaaaagcttagtgatgcacttgataatgtggatgtcatttatgttacaagaatt
caaaaggaacgaatgacaccttcagaactcccatcaccaaaggagtcctttaaagttgac
aagaatgtaatgtcagtgctaccaaaacatgccaaggttttacacccattaccgagagtg
gaagaggtttcgttagacgtcgattctgacgaaaggtgcgtattcttcgaacaagctgaa
aacggattatatgttagaatggctctgctgtatctgattttaaacaagtgttaa

DBGET integrated database retrieval system