KEGG   Theileria annulata: TA20650Help
Entry
TA20650           CDS       T00253                                 

Definition
(RefSeq) aspartate transcarbamoylase, putative
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tan  Theileria annulata
Pathway
tan00240  Pyrimidine metabolism
tan00250  Alanine, aspartate and glutamate metabolism
tan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TA20650
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TA20650
Enzymes [BR:tan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TA20650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 3864361
NCBI-ProteinID: XP_954289
GeneDB: TA20650
UniProt: Q4UH27
Position
1
AA seq 377 aa AA seqDB search
MKHFLKHSWVALGAGVVTVTALYALSFVPWVRVSLTELGLYCCDPLLHCLDAAKRKVASS
LRNKGLLFVDDLSNAQLSCIFEVADFFRKKLNQRLNLELLAGKVMTTLFCEPSTRTRCSF
ETAMLKLGGKVVSVTDSGSSFTKGESIDDSVRVLSSYSDVLVLRHPETNVIQRVKHQCMV
PLINAGDGSGEHPTQALLDLYTINRYFPVFSSEKEITVCLVGDLKYARTTHSLVRLLSRF
NVVLRYVSTPSLQMPTQIQREVEQNFAKYNIPDLAFPRQTSFKKLSDALDNVDVIYVTRI
QKERMTPSELPSPKESFKVDKNVMSVLPKHAKVLHPLPRVEEVSLDVDSDERCVFFEQAE
NGLYVRMALLYLILNKC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatttcttaaaacattcatgggtcgcccttggggcaggagttgtcactgtaacg
gctttatatgcgctttcatttgttccctgggttcgagttagcctaactgaacttggtttg
tactgttgtgaccctctattacactgtcttgatgctgcgaagagaaaggtcgcatcttct
cttagaaataaagggttgttgttcgtggatgatttgtccaatgcccagctgagttgtatt
tttgaagtggctgactttttcaggaaaaaacttaaccagcgactaaatcttgaactcctg
gccggaaaggtcatgacaaccctcttctgcgaacccagtactaggacaagatgttcattc
gagacggcaatgctaaagttaggtggtaaggtggtttcagtgactgattctggatcatca
ttcacaaagggcgaaagcatcgatgattcagttagagttttatcgtcatacagtgacgtt
ttggtgctccgtcaccctgaaactaatgttattcaacgtgttaaacaccaatgtatggtt
cctttgattaatgcaggagatggttcaggagaacacccaactcaagcactacttgattta
tataccatcaatagatacttcccagtattctcatctgaaaaggagattacagtgtgtttg
gtaggagaccttaaatatgctaggacaactcactctcttgtaaggcttttgagtcgattt
aatgttgttttgagatacgtctcaacaccctcacttcaaatgccaactcaaattcaacgt
gaagttgaacagaactttgcaaaatacaatattcctgatttggcttttccaaggcaaact
agtttcaaaaagcttagtgatgcacttgataatgtggatgtcatttatgttacaagaatt
caaaaggaacgaatgacaccttcagaactcccatcaccaaaggagtcctttaaagttgac
aagaatgtaatgtcagtgctaccaaaacatgccaaggttttacacccattaccgagagtg
gaagaggtttcgttagacgtcgattctgacgaaaggtgcgtattcttcgaacaagctgaa
aacggattatatgttagaatggctctgctgtatctgattttaaacaagtgttaa

DBGET integrated database retrieval system