KEGG   Theileria annulata: TA21080Help
Entry
TA21080           CDS       T00253                                 

Definition
Map2 kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tan  Theileria annulata
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 642 aa AA seqDB search
MRSDKVIKKGVHDFDRHDSRETHSHDRVHSSLVSKSKTKNLETDNFVFKNYVTKQSLLQS
RMSSVETDVPSTQYRSLISARKPQPNLNNYNQPENSLSAHNSSHVTNFTNNHSNYNSVNT
NYNQNYNTNYSSNLNNNYSGSNDKVLESSATLKGNYSTGTGAKYRPLKSTTLKKERPTIK
PPQSDIKWELGERYKFVDMVGSGSYGHVCRAYDSQLNKFVAIKRIHKVFDDLIDCKRILR
EIAILNRLDHPNVVKILDILVPDNLETFDVLYVVLEIAASDIKQLVRSPAFLNENHIRLL
VFNLLSGVHYLHSVGIYHRDLKPANCLINRDCSVKICDFGLARTTTFPEEFMESGSYSGR
EADVSYTSRPVESISTSYSTSRSLPDYAYCLGSSDRFSSDTASGNVSVNHFTSIATSKGP
MRQVYRRQLTGHVVTRWYRAPELILLQENYSFAVDIWSVGCIFAELLNMMKVNVSDPCDR
SPLFPGSSCFPLSPDNKNANPRTTRENDQLNLIFNVLGTPSEEDINCIQKADVRRYVKFF
AKRGFQDLRTKFKGASLESIDLLKKMLTFNPEKRISVFEALNHPYFKSISKPRSNFDSIP
KVTLPFNDWVNMSESQLRYSFLREIQRYHKDFKIPVKIIYRS
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggataaggttataaagaagggagttcatgactttgataggcatgactcgagg
gaaacccattcgcatgatagagtacactctagtctggtttcaaaatccaaaacaaagaat
ttggaaactgacaactttgtgtttaagaactatgtgacaaagcagtctcttttgcaaagt
aggatgagttcagttgaaactgatgttccatcaacacaatacagaagcctaatttctgca
cgtaaaccacagcccaatttaaacaactacaaccaaccagaaaattctctttctgcccac
aattcatcacatgtaactaatttcaccaataaccattccaactataatagtgttaacact
aactataatcagaactataacaccaattacagttccaacctcaacaataattatagtggt
agcaatgacaaagttttagaatcatctgctactttaaaagggaactatagcactggaact
ggtgcaaaatacagaccattaaagtctacaactcttaaaaaggaaaggccgacaattaag
cctccccaaagtgatataaagtgggaacttggggaaaggtataagtttgtggatatggtt
ggctcagggtcctatggtcatgtttgcagagcttatgactcacaacttaataagttcgtg
gccattaagaggatacataaggtgtttgatgacctgattgattgcaagagaatattgagg
gaaattgcaattttgaataggctggaccaccctaatgtagttaagattttggatatacta
gtccctgataatttggagacatttgatgttttgtacgtagttcttgaaatcgcagcttct
gatattaagcaattggtaaggtcacctgcctttttgaatgaaaaccacattaggcttctg
gtttttaacttactctctggagttcattaccttcactctgttgggatataccacagggac
ttaaaacctgctaattgtcttattaacagagattgtagtgtaaaaatctgtgattttgga
cttgctaggacaactaccttccccgaggagttcatggaatcaggctcttattctggaagg
gaggctgatgtttcatataccagcagacccgttgaaagtattagcactagctattcaact
tcgagatctttacctgattacgcctattgtcttggttcttctgatagatttagttcagac
actgcatctggaaacgtttcagttaatcatttcaccagcatagctacttcaaaaggtcca
atgaggcaggtttataggaggcagcttactgggcatgttgtaacaaggtggtacagggca
ccagagttgattctacttcaggaaaattactcttttgcagttgacatttggtcggttggt
tgtatttttgccgaacttttgaatatgatgaaggtgaacgttagtgatccttgtgataga
tctcctctgtttcctggaagttcttgcttcccactctcacccgacaacaagaatgctaat
ccaaggaccacacgtgaaaatgaccagctgaaccttatttttaatgtgcttggcactcca
tctgaggaggacattaactgcatacagaaagctgacgttcgtcgatatgtgaaatttttt
gccaaacgtggtttccaggacttgaggactaagttcaagggtgcttctttagaatctatt
gatttacttaaaaagatgctgacttttaatcctgaaaagcgaatctctgtcttcgaagct
cttaatcatccttactttaaatcaattagtaaacctaggagcaactttgattcaattccc
aaggtaactcttccttttaatgattgggttaacatgtctgaaagtcagttgagatattca
tttttacgtgaaattcaaagatatcacaaggattttaagattcccgtaaagatcatatat
cgctcatga

DBGET integrated database retrieval system