KEGG   Theileria annulata: TA21080Help
Entry
TA21080           CDS       T00253                                 

Definition
(RefSeq) Map2 kinase
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tan  Theileria annulata
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tan00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    TA21080
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TA21080
Protein kinases [BR:tan01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TA21080
Chromosome [BR:tan03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     TA21080
Exosome [BR:tan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TA21080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 642 aa AA seqDB search
MRSDKVIKKGVHDFDRHDSRETHSHDRVHSSLVSKSKTKNLETDNFVFKNYVTKQSLLQS
RMSSVETDVPSTQYRSLISARKPQPNLNNYNQPENSLSAHNSSHVTNFTNNHSNYNSVNT
NYNQNYNTNYSSNLNNNYSGSNDKVLESSATLKGNYSTGTGAKYRPLKSTTLKKERPTIK
PPQSDIKWELGERYKFVDMVGSGSYGHVCRAYDSQLNKFVAIKRIHKVFDDLIDCKRILR
EIAILNRLDHPNVVKILDILVPDNLETFDVLYVVLEIAASDIKQLVRSPAFLNENHIRLL
VFNLLSGVHYLHSVGIYHRDLKPANCLINRDCSVKICDFGLARTTTFPEEFMESGSYSGR
EADVSYTSRPVESISTSYSTSRSLPDYAYCLGSSDRFSSDTASGNVSVNHFTSIATSKGP
MRQVYRRQLTGHVVTRWYRAPELILLQENYSFAVDIWSVGCIFAELLNMMKVNVSDPCDR
SPLFPGSSCFPLSPDNKNANPRTTRENDQLNLIFNVLGTPSEEDINCIQKADVRRYVKFF
AKRGFQDLRTKFKGASLESIDLLKKMLTFNPEKRISVFEALNHPYFKSISKPRSNFDSIP
KVTLPFNDWVNMSESQLRYSFLREIQRYHKDFKIPVKIIYRS
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggataaggttataaagaagggagttcatgactttgataggcatgactcgagg
gaaacccattcgcatgatagagtacactctagtctggtttcaaaatccaaaacaaagaat
ttggaaactgacaactttgtgtttaagaactatgtgacaaagcagtctcttttgcaaagt
aggatgagttcagttgaaactgatgttccatcaacacaatacagaagcctaatttctgca
cgtaaaccacagcccaatttaaacaactacaaccaaccagaaaattctctttctgcccac
aattcatcacatgtaactaatttcaccaataaccattccaactataatagtgttaacact
aactataatcagaactataacaccaattacagttccaacctcaacaataattatagtggt
agcaatgacaaagttttagaatcatctgctactttaaaagggaactatagcactggaact
ggtgcaaaatacagaccattaaagtctacaactcttaaaaaggaaaggccgacaattaag
cctccccaaagtgatataaagtgggaacttggggaaaggtataagtttgtggatatggtt
ggctcagggtcctatggtcatgtttgcagagcttatgactcacaacttaataagttcgtg
gccattaagaggatacataaggtgtttgatgacctgattgattgcaagagaatattgagg
gaaattgcaattttgaataggctggaccaccctaatgtagttaagattttggatatacta
gtccctgataatttggagacatttgatgttttgtacgtagttcttgaaatcgcagcttct
gatattaagcaattggtaaggtcacctgcctttttgaatgaaaaccacattaggcttctg
gtttttaacttactctctggagttcattaccttcactctgttgggatataccacagggac
ttaaaacctgctaattgtcttattaacagagattgtagtgtaaaaatctgtgattttgga
cttgctaggacaactaccttccccgaggagttcatggaatcaggctcttattctggaagg
gaggctgatgtttcatataccagcagacccgttgaaagtattagcactagctattcaact
tcgagatctttacctgattacgcctattgtcttggttcttctgatagatttagttcagac
actgcatctggaaacgtttcagttaatcatttcaccagcatagctacttcaaaaggtcca
atgaggcaggtttataggaggcagcttactgggcatgttgtaacaaggtggtacagggca
ccagagttgattctacttcaggaaaattactcttttgcagttgacatttggtcggttggt
tgtatttttgccgaacttttgaatatgatgaaggtgaacgttagtgatccttgtgataga
tctcctctgtttcctggaagttcttgcttcccactctcacccgacaacaagaatgctaat
ccaaggaccacacgtgaaaatgaccagctgaaccttatttttaatgtgcttggcactcca
tctgaggaggacattaactgcatacagaaagctgacgttcgtcgatatgtgaaatttttt
gccaaacgtggtttccaggacttgaggactaagttcaagggtgcttctttagaatctatt
gatttacttaaaaagatgctgacttttaatcctgaaaagcgaatctctgtcttcgaagct
cttaatcatccttactttaaatcaattagtaaacctaggagcaactttgattcaattccc
aaggtaactcttccttttaatgattgggttaacatgtctgaaagtcagttgagatattca
tttttacgtgaaattcaaagatatcacaaggattttaagattcccgtaaagatcatatat
cgctcatga

DBGET integrated database retrieval system