KEGG   Theileria annulata: TA21275Help
Entry
TA21275           CDS       T00253                                 

Definition
ubiquitin carboxyl-terminal hydrolase (UBP14 ) (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TA21275
Peptidases [BR:tan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TA21275
Exosome [BR:tan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TA21275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 709 aa AA seqDB search
MTELSLEFDRLCNELGLSVPDPNTVVHKTECLYSIDNEYSVNGIYVNLLTYQSFGKEMLK
FDPIYPNCIYLNITKRLIPYKEEENEVNTNEESTHEEGVVFKEKKSYDESVEYKVYSPQL
GSIALDQTFGQLLNICNSIIGHAGYEFKNNELSFSDILQVKDYTIESKHSKDLYQVENPK
QINYENVKCEKCNSTTNLWLNLSDGYVGCGRKNYNSGGCQDGTEGAAILHYQETGSKYHL
AVKIGTITPTSADVYSYSQDEDNLVIDPLLEKHLKHFGINMNDLKKTEKTLLQLEIEDNK
NYNWLTDTDGSSLIHLEPRLIGILNLGNNCYLNSVLQLLNNVNEMNAFFINYYKVNFENR
FENVNLFLLQYAKICTCINTTVFINKCNYILEHYKKLKLAESNNSSDEDVSDILTHNCFY
INPNLFKYTLGMNSNVFNNNEQQDAEEFLSYFINYLFDNVKEVKSLFNIELKQIIICNEL
KLINVNKIQTHILPLELINVINTKHLSNPLSNVDTNEIEIDINECLSGWYNGAMVDYINN
GKVHKANLYNNLTNSPTYLFVKLNRFYMDKNVPKKLLNKVSVTGEHLQLNLNNLNLKEFG
DYKLSGSENNKGFYENLKLLGFYGNSVDKVVNYYENLNQSQEHDGDHERTTVSYNLIGFI
THIGSNVNSGHYICHLKKDNEWYAFNDTRISKSTNPPIHNGYIYLFQKS
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgactgagttatctcttgaattcgacagactgtgtaatgaattaggcttatcggttccg
gatcctaacacagttgtacataaaacagagtgtttatacagtatcgataatgaatattct
gtcaacggaatctatgtaaatttactgacataccaatcctttgggaaggaaatgctcaaa
tttgatccaatataccccaattgtatatatttgaacataacaaaaagattaattccctac
aaagaggaggaaaatgaagtgaacactaatgaagaatcaacacacgaggaaggtgtagtt
tttaaggaaaagaaatcctatgatgaaagtgttgaatataaagtctactcgccacagtta
ggctcgatagcgctggaccaaacatttggccaactattaaacatttgcaattcaataatt
ggacatgccggatatgaattcaaaaataacgaactttctttttcagatattttacaagta
aaagattacacaatagaaagtaaacatagtaaggatttataccaagttgagaatccaaaa
caaataaactatgaaaatgtgaagtgtgaaaagtgcaattccacaacgaatttgtggtta
aacctatccgacggatacgttgggtgtggaagaaagaactataacagcgggggttgccaa
gatggtacagaaggagcagcaatacttcattatcaagaaacaggatccaaatatcacttg
gcagtaaaaattggaactataacaccaacatcagctgatgtgtatagttactcacaggat
gaagataatttagtaattgacccattgttagaaaaacatttgaaacactttggaatcaat
atgaatgatttgaaaaaaacggaaaaaacactcttgcaacttgaaatcgaagacaataaa
aattataattggctaacagatacagatggctcatcattaatacatttagaaccaagattg
attgggatattgaatttggggaacaactgttacctcaacagtgtcttgcagcttttaaat
aatgtaaacgagatgaacgcattttttattaattattacaaagttaacttcgagaataga
tttgaaaatgttaatttatttctactccagtatgccaagatctgcacatgcatcaatacc
acggtttttattaacaagtgcaattacattcttgagcactacaaaaaattaaaactggct
gaatccaacaactcgagcgacgaagatgtgagtgatatactaacacataactgtttttac
attaacccaaaccttttcaaatacacactgggaatgaatagtaatgtgttcaataataac
gaacaacaagacgcagaagagttcttgagttatttcataaattatctgttcgacaatgtt
aaggaagtcaaatcactattcaacattgagctaaaacaaatcataatctgtaacgagtta
aagttgattaacgtaaacaagatacaaacacacattttgccgcttgaactgattaacgtg
atcaacactaagcatctgagtaatccactatcaaatgtggatacaaatgagatagaaatc
gatataaacgaatgtttatcgggatggtacaacggtgcaatggtagattacataaataac
ggaaaggtccacaaggctaatttgtataacaacctaacgaattcacccacttatttgttc
gttaagctgaaccgtttttacatggacaaaaatgtcccgaagaagttactcaacaaagtc
tcagttactggagaacatttgcaattgaatttgaataaccttaacttgaaggaatttgga
gattacaaactctcaggctcagagaataataaaggattttacgaaaacttgaagttgcta
ggtttctatggaaactcggtggataaagtcgtaaattattacgaaaacttaaatcaaagc
caagaacatgacggggaccatgagagaacaacagtctcttacaacctgattggattcata
acacacattggaagtaacgtcaactcaggacattacatttgtcacctaaagaaggataac
gaatggtacgctttcaatgataccagaattagcaagtccactaatcctccaatacataat
ggatacatttatctatttcaaaagtcataa

DBGET integrated database retrieval system