KEGG   Thermoplasmatales archaeon BRNA1: TALC_00083Help
Entry
TALC_00083        CDS       T02532                                 

Definition
phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tar  Thermoplasmatales archaeon BRNA1
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tar00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    TALC_00083
Enzymes [BR:tar01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     TALC_00083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(69921..71216)
Genome map
AA seq 431 aa AA seqDB search
MAIVYTCFSTDIVHEGHLNIIKNAQKYGDVYVGVLSDKATIRYNKFPTVSFEDRFKMIEA
IPGVTRVLVQDDVMYDGIVKQIRPDYIIHGDNWKTGAMKAIRDNAEKLIAPYGGKIIDVP
YTFSESVRREDARIKEKLAMPEYRRKRLKQLLALRPIVKAMEVHSGLTGLIVEKTCVEHN
GEIDQFDAMWLSSLCDSTAKGKPDIEVVDMTSRFRTIDDVMEVTTKPIIFDGDTGGLPEH
FVYIVRSLERMGVSAVIIEDKTGLKKNSLFGTEVKQTQDSIENFCEKIKAGKRVQLTDDF
MIIARIESLILEQGMDDALARARAYVAAGADGIMIHSRKNDPAEILEFCDLFRKENKDTP
IVVVPTSFNSITESELAEHGVNIVIYANQLTRSAFPAMEQTAKDILRYHRAQEVDSRLLP
IKDIISLIDEL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtctacacttgtttcagcacggacatcgtgcacgaggggcacctcaacatc
atcaagaacgcccagaagtacggcgacgtttacgtgggggtcctttccgacaaggccacg
atccgctacaacaagttcccgacggtctccttcgaggaccgcttcaagatgattgaggcc
atccccggggtcaccagggtcctcgtccaggacgatgtcatgtacgacggcatcgtcaag
cagatccgtcccgattacatcatccacggcgacaactggaagaccggtgccatgaaggcc
atccgtgacaacgccgagaagctcatcgccccctacggcggcaaaattatcgacgtcccc
tacaccttcagcgagagcgtgaggagggaggatgccaggatcaaggagaagctcgccatg
cccgagtataggaggaagcgtctgaagcagctcctggcactccgccccatcgtcaaggct
atggaggttcacagcggccttaccgggctcatcgtcgagaagacctgcgtggagcacaac
ggcgagattgatcagttcgacgccatgtggctgagctccctctgcgattccaccgccaag
ggcaagcccgacatcgaggtcgtcgacatgacctccaggttcaggaccatagatgacgtc
atggaggtcaccaccaagccgatcatcttcgacggcgacaccggagggcttcccgagcac
ttcgtttacatcgtacgctccctcgagaggatgggcgtgtccgcggtcatcatcgaagac
aagacaggtctcaagaagaactccctcttcggcaccgaggtcaaacagacccaggactcc
atcgagaacttctgcgagaagatcaaggccgggaagagggtgcagctcaccgatgacttc
atgatcatcgccaggatcgagagcctcatcctggaacagggcatggatgacgctttagcc
agggccagggcatatgttgccgcgggagcggacggaatcatgatccacagcaggaaaaat
gatcccgcggagatcctcgagttctgcgacctgttcaggaaggagaacaaggacactccc
atcgtggtcgtcccgacctctttcaactccatcaccgaatcggaacttgctgaacatggt
gtgaacatcgtcatctacgccaaccagctcacccgcagcgcgttccccgccatggaacag
accgcgaaggacatcctcaggtaccaccgggcccaagaagtcgactcccgtctacttccg
atcaaggacatcatctcacttatagacgaactctga

DBGET integrated database retrieval system