KEGG   Thermoplasmatales archaeon BRNA1: TALC_01212Help
Entry
TALC_01212        CDS       T02532                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tar  Thermoplasmatales archaeon BRNA1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TALC_01212
Enzymes [BR:tar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TALC_01212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1128475..1129266
Genome map
AA seq 263 aa AA seqDB search
MISVGFTRPPERIAEAEQEIRKRGMQPYGAPSLVSVRGRDSVFEEIEETLSSGEAYFTVF
ASITAVECVVEEYGKEKVLALLSETNVACTGPSTEAAMQRLLGRGCDLVPEVYSGVGIAT
EIADEVCDKTVLILRSAEGDGGIVTILEEAGAVVLDEAVYAMEPAPFSPAHSALLDALGD
GEIDVMLFTSPKSFTILLEQAEKWLGAGRAHSSLESVCKMAIGLPTSKAMEKYGLEPQIL
PEKSTFAGMLDAVEENASLFRRA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatatcggtcggattcacccgcccgccggaaaggatcgcggaagcagagcaggagatc
aggaagagggggatgcagccctacggcgccccctccctggtatccgtccgcggaagggac
tccgtcttcgaagagatagaggagaccctctcctccggcgaggcgtacttcaccgtgttc
gcatccatcacggccgtcgagtgcgtcgtggaagaatacggaaaagagaaggttctggca
cttttatcagagaccaatgtcgcctgcaccggaccgagcaccgaggccgccatgcagagg
ctgctcggacgcggatgcgacctcgtacccgaggtctactccggggtcggcatcgccacc
gagatcgccgacgaggtctgcgacaagaccgttctcatcctccgttccgccgagggcgac
ggcggaatcgtgaccatactcgaagaggcgggggcggtcgtgctcgacgaagccgtctac
gcgatggaacccgctccgttctctcccgcgcattccgcactcctcgatgccctcggggac
ggggagatcgacgtcatgctcttcaccagccccaaatcgttcaccatcctcctcgagcag
gcggagaagtggctgggcgcggggagggcacattcatctctggaatcggtatgcaagatg
gccataggcctgcccacgtcgaaggcgatggagaaatacggtctggaaccccagatcctt
cccgagaaatccaccttcgccggcatgctcgatgccgtcgaggaaaatgcatcgctcttc
aggcgcgcttga

DBGET integrated database retrieval system