KEGG   Taylorella asinigenitalis MCE3: TASI_0142Help
Entry
TASI_0142         CDS       T01634                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TASI_0142
   01230 Biosynthesis of amino acids
    TASI_0142
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0142
  Energy metabolism
   00680 Methane metabolism
    TASI_0142
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TASI_0142
Enzymes [BR:tas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TASI_0142
Exosome [BR:tas04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TASI_0142
  Exosomal proteins of melanoma cells
   TASI_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
145241..146011
Genome map
AA seq 256 aa AA seqDB search
MRFPNGQLMYKLVLMRHGESQWNLENRFTGWADVDLTDTGRQQAKEAGALLKAEGFDFDI
AYTSVLKRAIRTLWIALDEMDRLHLPVVKSWRLNERHYGNLQGLNKSETAQKFGDEQVLI
WRRAYAIAPDPIDTEDKRHPKFDARYKDLDASQLPSTECLNDTVARVIPLWNEQISEDIK
AGKRVLITAHGNSLRALIKHLDQISDEDIVTLNIPTGQPLVYELDENLKPIKHYYLGDQE
AIAAAVAAVAAQGKAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgagatttcctaacggacagcttatgtataaattagttttaatgcgtcatggtgagagt
cagtggaacctagaaaaccgttttacgggatgggctgatgtagatctcaccgacacaggt
cgtcagcaagcgaaagaagcaggagccttactgaaagctgaggggtttgactttgacatt
gcctacacatcagtattaaaaagggcaattcgcacactatggattgctttagatgagatg
gataggttgcatctgccagtagtaaagtcgtggagactgaatgagcgtcactacgggaat
ctgcaaggcttgaataaatcggagacagcccaaaaattcggggacgaacaagtcctaatt
tggagaagggcatatgcgattgcccccgatcctattgatacagaagataagcgtcatcct
aaatttgatgcgagatataaagatttagatgcctctcaattaccaagcacggagtgtctt
aatgatacggtcgcacgcgtaattccattatggaatgagcaaatctccgaggatattaag
gctggaaagcgtgtattaatcacagcccacggaaatagtttacgtgcattgattaaacat
ttggatcagataagcgatgaggatatcgtaactttaaatattcctacaggccaacctcta
gtttatgagctagacgagaatcttaagccaattaaacattattatcttggcgatcaggag
gccattgccgctgctgtggctgctgttgctgctcaaggaaaggccaagtaa

DBGET integrated database retrieval system