KEGG   Taylorella asinigenitalis MCE3: TASI_0142Help
Entry
TASI_0142         CDS       T01634                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TASI_0142
   01230 Biosynthesis of amino acids
    TASI_0142
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0142
  Energy metabolism
   00680 Methane metabolism
    TASI_0142
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TASI_0142
Enzymes [BR:tas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TASI_0142
Exosome [BR:tas04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TASI_0142
  Exosomal proteins of melanoma cells
   TASI_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
145241..146011
Genome map
AA seq 256 aa AA seqDB search
MRFPNGQLMYKLVLMRHGESQWNLENRFTGWADVDLTDTGRQQAKEAGALLKAEGFDFDI
AYTSVLKRAIRTLWIALDEMDRLHLPVVKSWRLNERHYGNLQGLNKSETAQKFGDEQVLI
WRRAYAIAPDPIDTEDKRHPKFDARYKDLDASQLPSTECLNDTVARVIPLWNEQISEDIK
AGKRVLITAHGNSLRALIKHLDQISDEDIVTLNIPTGQPLVYELDENLKPIKHYYLGDQE
AIAAAVAAVAAQGKAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgagatttcctaacggacagcttatgtataaattagttttaatgcgtcatggtgagagt
cagtggaacctagaaaaccgttttacgggatgggctgatgtagatctcaccgacacaggt
cgtcagcaagcgaaagaagcaggagccttactgaaagctgaggggtttgactttgacatt
gcctacacatcagtattaaaaagggcaattcgcacactatggattgctttagatgagatg
gataggttgcatctgccagtagtaaagtcgtggagactgaatgagcgtcactacgggaat
ctgcaaggcttgaataaatcggagacagcccaaaaattcggggacgaacaagtcctaatt
tggagaagggcatatgcgattgcccccgatcctattgatacagaagataagcgtcatcct
aaatttgatgcgagatataaagatttagatgcctctcaattaccaagcacggagtgtctt
aatgatacggtcgcacgcgtaattccattatggaatgagcaaatctccgaggatattaag
gctggaaagcgtgtattaatcacagcccacggaaatagtttacgtgcattgattaaacat
ttggatcagataagcgatgaggatatcgtaactttaaatattcctacaggccaacctcta
gtttatgagctagacgagaatcttaagccaattaaacattattatcttggcgatcaggag
gccattgccgctgctgtggctgctgttgctgctcaaggaaaggccaagtaa

DBGET integrated database retrieval system