KEGG   Taylorella asinigenitalis MCE3: TASI_0230Help
Entry
TASI_0230         CDS       T01634                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tas  Taylorella asinigenitalis MCE3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
234178..235017
Genome map
AA seq 279 aa AA seqDB search
MKLKFNSIFAVLTLSSFASVVAAQNAAVVPPLGAVEKAPVEQTKAEKAEATSEKSNVEKA
GALPQEKINAITSNIEKSFGVKVLEVNATPYTGLFEVLTNETIVYTDADSSFILAGHLFD
TKTTDNLTQQRVKEQSAKAFAKLPVGEAVKRVKGKGTRKLVTFEDPNCRYCKALYKELEQ
MDDVTIYTFLVPILAKDSVTKVRDIMCSSNPALTWHEWIEKGQKPAPQSKANCEEPNPKT
LDLARSVDVRGVPVILFPNGERRNGFVRLSEIEEIISQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaaaatttaattctatatttgcggtgcttactttgtcttcatttgcttctgtt
gtagcggctcaaaatgcggctgtggtgccgcctttgggggccgtggagaaagcacctgtt
gaacaaactaaagcggagaaggctgaggcgacttcggaaaaatcaaatgtggagaaagcg
ggggcattgccacaagagaaaattaatgcaattacatctaacatcgaaaaatcttttggc
gtaaaggtgcttgaagtgaatgccactccatatacgggcctgttcgaggttttgacaaat
gagactattgtctacacagatgcggatagttcgttcattcttgctgggcatttatttgat
acgaaaacgaccgacaatcttactcaacaacgcgtaaaggagcagtcggcaaaggcgttt
gcaaaattgcctgtgggtgaggctgtcaagcgcgtcaaaggcaaggggactagaaaactt
gtgacatttgaggatccgaattgcagatattgtaaggctctctataaggagcttgagcaa
atggatgatgtaactatatacacttttttagttcctatattagctaaggattctgtaact
aaggtgcgtgatatcatgtgctcatcgaatcctgcattgacatggcatgaatggattgaa
aagggccaaaagcctgctcctcaaagcaaagcgaattgcgaagagccgaatcctaaaact
ctcgatttagctagaagcgtggatgtaaggggtgttccagtgattttatttccgaacggg
gagcgtcgaaatggttttgtgcgtctctctgaaatcgaagagataatttcacaaaaataa

DBGET integrated database retrieval system