KEGG   Taylorella asinigenitalis MCE3: TASI_0329Help
Entry
TASI_0329         CDS       T01634                                 

Definition
hypothetical protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0329
   00030 Pentose phosphate pathway
    TASI_0329
   00051 Fructose and mannose metabolism
    TASI_0329
   00052 Galactose metabolism
    TASI_0329
   00500 Starch and sucrose metabolism
    TASI_0329
   00520 Amino sugar and nucleotide sugar metabolism
    TASI_0329
  Nucleotide metabolism
   00230 Purine metabolism
    TASI_0329
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TASI_0329
Enzymes [BR:tas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TASI_0329
    5.4.2.8  phosphomannomutase
     TASI_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(332175..333602)
Genome map
AA seq 475 aa AA seqDB search
MYKLPVKVFKEYDIRGKYPEEINPQFAYILGIALMKIFAPNRLGCVLIAHDAREGGQELA
KALYHALKTKVPENKIKFLGLQHSGGLGVLNLSIDGALAIYITASHNPLGYHGFKIYIDR
LPFNSELINIVKVSALSLIGADASAYKFDAENFAEPPIERLDNSYYIDAILAEPFLEQPK
YKFRVAVDGGNGVGGIIASELYRKMGHEVLELNCEPDGSFPNHHPDPSIPENMVQLQNFV
RENNCDIGLAFDGDADRLGVVDYRGEIVDPDRVFIFFIRQMMKYHLSHEMLHKGEKVKIA
YDLKSSRHIEKEILKAGALPLICKTGHSNMTWDIHHKDGVLFGAEYSGHYYFFKDGYVLN
DGVYSGYKLLRFLSLAGREAFDNLPQDESIPELRIPYSHEHITEFLAFAKDEATALLKPK
QIIEIDGIRIETEHGFLLIRPSKTEEVLSIRAEADSKEHLEALLDFVHAKIAEFG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctgccagttaaagtatttaaagaatacgatattaggggcaaatacccagag
gaaattaaccctcaatttgcttatatcttaggtattgctctaatgaaaatatttgcacct
aatagacttggatgtgtccttattgctcacgatgccagagaaggcggacaagaattggcc
aaagccttatatcacgctcttaaaacaaaagttcctgaaaataaaattaaatttttgggc
ttgcagcattcagggggtttgggcgttctgaatctgagcatagatggtgctctggcgatt
tatattacggcaagtcacaatccactaggctatcacggattcaaaatatatatcgatcgc
ttaccctttaatagtgaactaataaatatcgtaaaagtcagtgccttaagtcttataggg
gctgatgcgagtgcatataaatttgatgcagaaaatttcgctgagccccctattgagagg
cttgataattcctactatatagatgcgattttggctgagccttttttggaacagccgaag
tataaatttagagttgctgttgacggtggcaatggagtcggcggtatcattgccagtgaa
ctctacagaaaaatgggacacgaggtgttggaattaaattgcgagccagatgggagtttt
ccgaatcatcatccagacccgtcaattcctgaaaatatggttcagctacaaaattttgtt
cgcgaaaacaactgtgatattggcttagcatttgacggagatgcggatagactgggcgtt
gtagattatcgcggtgaaattgtggacccagatcgtgtattcattttctttatacggcaa
atgatgaaatatcatctttctcatgaaatgctacataaaggcgaaaaagtaaaaattgcg
tatgaccttaaatcaagtaggcatattgaaaaagagattttgaaagcgggggcattgcca
ctgatatgtaaaacagggcactcaaatatgacatgggatattcatcataaagacggtgtg
ttgtttggggctgaatacagtggacactactattttttcaaagacggttatgttttaaac
gatggggtctactcagggtataagctattgcgatttctatcattggccgggcgtgaggct
ttcgataatttgccgcaagatgagtcaattccagagctacggattccatattcacacgaa
cacattacggagtttttggcttttgcgaaagacgaagctaccgctttactaaagccgaaa
cagattattgaaattgatggaattaggattgaaacagagcatggattcttattgatacgg
ccctcaaaaacggaagaagtgctttcgatacgggcagaggcagattccaaggagcattta
gaggctttgcttgattttgtacacgcaaaaattgcagaattcggctaa

DBGET integrated database retrieval system