KEGG   Taylorella asinigenitalis MCE3: TASI_0329Help
Entry
TASI_0329         CDS       T01634                                 

Definition
(GenBank) hypothetical protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00010  Glycolysis / Gluconeogenesis
tas00030  Pentose phosphate pathway
tas00051  Fructose and mannose metabolism
tas00052  Galactose metabolism
tas00230  Purine metabolism
tas00500  Starch and sucrose metabolism
tas00520  Amino sugar and nucleotide sugar metabolism
tas00521  Streptomycin biosynthesis
tas01100  Metabolic pathways
tas01110  Biosynthesis of secondary metabolites
tas01120  Microbial metabolism in diverse environments
tas01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0329
   00030 Pentose phosphate pathway
    TASI_0329
   00051 Fructose and mannose metabolism
    TASI_0329
   00052 Galactose metabolism
    TASI_0329
   00500 Starch and sucrose metabolism
    TASI_0329
   00520 Amino sugar and nucleotide sugar metabolism
    TASI_0329
  Nucleotide metabolism
   00230 Purine metabolism
    TASI_0329
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TASI_0329
Enzymes [BR:tas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TASI_0329
    5.4.2.8  phosphomannomutase
     TASI_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AEP36111
UniProt: G4QCI1
Position
complement(332175..333602)
Genome map
AA seq 475 aa AA seqDB search
MYKLPVKVFKEYDIRGKYPEEINPQFAYILGIALMKIFAPNRLGCVLIAHDAREGGQELA
KALYHALKTKVPENKIKFLGLQHSGGLGVLNLSIDGALAIYITASHNPLGYHGFKIYIDR
LPFNSELINIVKVSALSLIGADASAYKFDAENFAEPPIERLDNSYYIDAILAEPFLEQPK
YKFRVAVDGGNGVGGIIASELYRKMGHEVLELNCEPDGSFPNHHPDPSIPENMVQLQNFV
RENNCDIGLAFDGDADRLGVVDYRGEIVDPDRVFIFFIRQMMKYHLSHEMLHKGEKVKIA
YDLKSSRHIEKEILKAGALPLICKTGHSNMTWDIHHKDGVLFGAEYSGHYYFFKDGYVLN
DGVYSGYKLLRFLSLAGREAFDNLPQDESIPELRIPYSHEHITEFLAFAKDEATALLKPK
QIIEIDGIRIETEHGFLLIRPSKTEEVLSIRAEADSKEHLEALLDFVHAKIAEFG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctgccagttaaagtatttaaagaatacgatattaggggcaaatacccagag
gaaattaaccctcaatttgcttatatcttaggtattgctctaatgaaaatatttgcacct
aatagacttggatgtgtccttattgctcacgatgccagagaaggcggacaagaattggcc
aaagccttatatcacgctcttaaaacaaaagttcctgaaaataaaattaaatttttgggc
ttgcagcattcagggggtttgggcgttctgaatctgagcatagatggtgctctggcgatt
tatattacggcaagtcacaatccactaggctatcacggattcaaaatatatatcgatcgc
ttaccctttaatagtgaactaataaatatcgtaaaagtcagtgccttaagtcttataggg
gctgatgcgagtgcatataaatttgatgcagaaaatttcgctgagccccctattgagagg
cttgataattcctactatatagatgcgattttggctgagccttttttggaacagccgaag
tataaatttagagttgctgttgacggtggcaatggagtcggcggtatcattgccagtgaa
ctctacagaaaaatgggacacgaggtgttggaattaaattgcgagccagatgggagtttt
ccgaatcatcatccagacccgtcaattcctgaaaatatggttcagctacaaaattttgtt
cgcgaaaacaactgtgatattggcttagcatttgacggagatgcggatagactgggcgtt
gtagattatcgcggtgaaattgtggacccagatcgtgtattcattttctttatacggcaa
atgatgaaatatcatctttctcatgaaatgctacataaaggcgaaaaagtaaaaattgcg
tatgaccttaaatcaagtaggcatattgaaaaagagattttgaaagcgggggcattgcca
ctgatatgtaaaacagggcactcaaatatgacatgggatattcatcataaagacggtgtg
ttgtttggggctgaatacagtggacactactattttttcaaagacggttatgttttaaac
gatggggtctactcagggtataagctattgcgatttctatcattggccgggcgtgaggct
ttcgataatttgccgcaagatgagtcaattccagagctacggattccatattcacacgaa
cacattacggagtttttggcttttgcgaaagacgaagctaccgctttactaaagccgaaa
cagattattgaaattgatggaattaggattgaaacagagcatggattcttattgatacgg
ccctcaaaaacggaagaagtgctttcgatacgggcagaggcagattccaaggagcattta
gaggctttgcttgattttgtacacgcaaaaattgcagaattcggctaa

DBGET integrated database retrieval system