KEGG   Taylorella asinigenitalis MCE3: TASI_0333Help
Entry
TASI_0333         CDS       T01634                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TASI_0333
Enzymes [BR:tas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TASI_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337571..338500
Genome map
AA seq 309 aa AA seqDB search
MRILKVPAPAKLNLFLHLTGRRPDGYHNLQSAFVLINLCDELVFELIEEDEVRIEILDKR
AGASFLNQKIDIPDNQNLVFRAATKLKEMAKLRGVEISGVMIRVEKQIPLGAGLGGGSSD
CASTLMALNKIWNLELSCEELKQIGLSLGADVPFFIGGKSALVEGIGEILKPFHLNPLWF
VLINPGFSISTPQVFTHPKLNRNFRVMDSDAIEKARAEINAGRFYGSNYLESAAFEIRPE
LANFLDFAKPLQLRMSGSGSSIFSMHVSSDDAETAYADLLAKLEEQKDIRSYECGVYKSY
EKHPIFDVL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttaaaagtaccagctcctgcgaaattaaatctttttttgcatcttactggc
agacgtcccgacggatatcataatctgcagtcagcttttgtattaattaatctctgtgat
gaacttgtgtttgaacttatcgaagaggatgaagttcgaattgagattttggacaaaaga
gctggtgcgagttttctaaatcaaaagattgatataccagataatcagaatctagttttt
agggcggccacaaaacttaaggaaatggctaagttgcgaggggttgagatatctggtgtt
atgattcgagttgaaaagcaaattccacttggagcagggcttggtggcggatcgagcgat
tgtgcaagtacattgatggctttaaataagatttggaatttagagcttagttgtgaagaa
cttaagcaaataggtttaagcttaggtgcggatgtccctttttttattggcggaaagtcg
gccttggttgaaggcataggtgaaattcttaaaccatttcacttgaatccattgtggttt
gttttaattaatccaggctttagcatatcaacgccccaagtttttactcaccctaagtta
aatcgaaactttagagttatggattctgatgccattgaaaaagcaagagctgaaattaat
gcaggacgattttatggttctaattatttggaatcagctgcatttgaaattaggccagaa
ctagctaattttttggattttgcaaagcctcttcaattgcgtatgtctggttcgggctca
agtatttttagtatgcatgttagttctgatgatgctgaaactgcgtatgctgatttgtta
gctaaattagaggaacagaaggacattcgatcatatgaatgtggtgtatacaaaagctat
gagaagcaccctatctttgatgttttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system