KEGG   Taylorella asinigenitalis MCE3: TASI_0409Help
Entry
TASI_0409         CDS       T01634                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00010  Glycolysis / Gluconeogenesis
tas00051  Fructose and mannose metabolism
tas00562  Inositol phosphate metabolism
tas01100  Metabolic pathways
tas01110  Biosynthesis of secondary metabolites
tas01120  Microbial metabolism in diverse environments
tas01130  Biosynthesis of antibiotics
tas01200  Carbon metabolism
tas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0409
   00051 Fructose and mannose metabolism
    TASI_0409
   00562 Inositol phosphate metabolism
    TASI_0409
Enzymes [BR:tas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TASI_0409
Exosome [BR:tas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TASI_0409
  Exosomal proteins of bladder cancer cells
   TASI_0409
  Exosomal proteins of melanoma cells
   TASI_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEP36185
UniProt: G4QCQ5
Position
415932..416675
Genome map
AA seq 247 aa AA seqDB search
MNGSIQANHSLMLSILDGISLWSLPIKQEVVVCPPFPYLQQIRDILALEAEEAFDPISLG
AQDLSVYENGAHTGDVSAQMLTDLGCKWVIVGHSERKATHFETAASVADKARIAVAAGLT
PIVCLGESKEMREAGQALHNIDIQLQPILEVGPDLIRSCVFAYEPIWAIGSGSIATSEQI
FEMHSHIRRQIQSVTGQEGSPVRIIYGGSVKADQARELFSLDCVDGALVGGASLDAEEFL
SIIDAAS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcagcattcaagctaaccattcacttatgctttctattttagatgggatatca
ttgtggtctttacctataaaacaagaggtcgtagtttgcccgccgtttccatatcttcag
caaattcgcgatattttagctttagaagcggaagaggcttttgatccgatttctcttggt
gcacaggatttaagtgtttacgaaaacggtgctcatacaggtgatgtctcagctcagatg
cttacagatttaggatgtaagtgggttatagttggtcattccgagcgaaaagcaacgcat
tttgaaactgctgcttcagtagccgataaagcccgtatagctgttgctgcgggactaact
cctatagtatgtttaggtgaaagtaaggaaatgcgtgaagctggtcaagcattacataat
attgacattcagcttcagccgattcttgaagtagggcctgatttgattaggtcatgcgtt
tttgcttatgaacctatttgggcgattggatcgggaagcattgccacaagcgagcagatt
tttgagatgcactcgcacattagacgtcagattcaatctgtgactgggcaagagggttca
cccgttcgcattatttatggtggtagtgtaaaggcggatcaggctcgagagttatttagt
cttgattgtgtagacggagctttagttggtggtgcttcactagatgctgaagaatttttg
agcattatagatgccgcatcttaa

DBGET integrated database retrieval system