KEGG   Taylorella asinigenitalis MCE3: TASI_0409Help
Entry
TASI_0409         CDS       T01634                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tas01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tas01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tas00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tas00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tas00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
415932..416675
Genome map
AA seq 247 aa AA seqDB search
MNGSIQANHSLMLSILDGISLWSLPIKQEVVVCPPFPYLQQIRDILALEAEEAFDPISLG
AQDLSVYENGAHTGDVSAQMLTDLGCKWVIVGHSERKATHFETAASVADKARIAVAAGLT
PIVCLGESKEMREAGQALHNIDIQLQPILEVGPDLIRSCVFAYEPIWAIGSGSIATSEQI
FEMHSHIRRQIQSVTGQEGSPVRIIYGGSVKADQARELFSLDCVDGALVGGASLDAEEFL
SIIDAAS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcagcattcaagctaaccattcacttatgctttctattttagatgggatatca
ttgtggtctttacctataaaacaagaggtcgtagtttgcccgccgtttccatatcttcag
caaattcgcgatattttagctttagaagcggaagaggcttttgatccgatttctcttggt
gcacaggatttaagtgtttacgaaaacggtgctcatacaggtgatgtctcagctcagatg
cttacagatttaggatgtaagtgggttatagttggtcattccgagcgaaaagcaacgcat
tttgaaactgctgcttcagtagccgataaagcccgtatagctgttgctgcgggactaact
cctatagtatgtttaggtgaaagtaaggaaatgcgtgaagctggtcaagcattacataat
attgacattcagcttcagccgattcttgaagtagggcctgatttgattaggtcatgcgtt
tttgcttatgaacctatttgggcgattggatcgggaagcattgccacaagcgagcagatt
tttgagatgcactcgcacattagacgtcagattcaatctgtgactgggcaagagggttca
cccgttcgcattatttatggtggtagtgtaaaggcggatcaggctcgagagttatttagt
cttgattgtgtagacggagctttagttggtggtgcttcactagatgctgaagaatttttg
agcattatagatgccgcatcttaa

DBGET integrated database retrieval system