KEGG   Taylorella asinigenitalis MCE3: TASI_0409Help
Entry
TASI_0409         CDS       T01634                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TASI_0409
   01230 Biosynthesis of amino acids
    TASI_0409
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0409
   00051 Fructose and mannose metabolism
    TASI_0409
   00562 Inositol phosphate metabolism
    TASI_0409
Enzymes [BR:tas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TASI_0409
Exosome [BR:tas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TASI_0409
  Exosomal proteins of bladder cancer cells
   TASI_0409
  Exosomal proteins of melanoma cells
   TASI_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
415932..416675
Genome map
AA seq 247 aa AA seqDB search
MNGSIQANHSLMLSILDGISLWSLPIKQEVVVCPPFPYLQQIRDILALEAEEAFDPISLG
AQDLSVYENGAHTGDVSAQMLTDLGCKWVIVGHSERKATHFETAASVADKARIAVAAGLT
PIVCLGESKEMREAGQALHNIDIQLQPILEVGPDLIRSCVFAYEPIWAIGSGSIATSEQI
FEMHSHIRRQIQSVTGQEGSPVRIIYGGSVKADQARELFSLDCVDGALVGGASLDAEEFL
SIIDAAS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcagcattcaagctaaccattcacttatgctttctattttagatgggatatca
ttgtggtctttacctataaaacaagaggtcgtagtttgcccgccgtttccatatcttcag
caaattcgcgatattttagctttagaagcggaagaggcttttgatccgatttctcttggt
gcacaggatttaagtgtttacgaaaacggtgctcatacaggtgatgtctcagctcagatg
cttacagatttaggatgtaagtgggttatagttggtcattccgagcgaaaagcaacgcat
tttgaaactgctgcttcagtagccgataaagcccgtatagctgttgctgcgggactaact
cctatagtatgtttaggtgaaagtaaggaaatgcgtgaagctggtcaagcattacataat
attgacattcagcttcagccgattcttgaagtagggcctgatttgattaggtcatgcgtt
tttgcttatgaacctatttgggcgattggatcgggaagcattgccacaagcgagcagatt
tttgagatgcactcgcacattagacgtcagattcaatctgtgactgggcaagagggttca
cccgttcgcattatttatggtggtagtgtaaaggcggatcaggctcgagagttatttagt
cttgattgtgtagacggagctttagttggtggtgcttcactagatgctgaagaatttttg
agcattatagatgccgcatcttaa

DBGET integrated database retrieval system