KEGG   Taylorella asinigenitalis MCE3: TASI_0409Help
Entry
TASI_0409         CDS       T01634                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TASI_0409
   01230 Biosynthesis of amino acids
    TASI_0409
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0409
   00051 Fructose and mannose metabolism
    TASI_0409
   00562 Inositol phosphate metabolism
    TASI_0409
Enzymes [BR:tas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TASI_0409
Exosome [BR:tas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TASI_0409
  Exosomal proteins of bladder cancer cells
   TASI_0409
  Exosomal proteins of melanoma cells
   TASI_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
415932..416675
Genome map
AA seq 247 aa AA seqDB search
MNGSIQANHSLMLSILDGISLWSLPIKQEVVVCPPFPYLQQIRDILALEAEEAFDPISLG
AQDLSVYENGAHTGDVSAQMLTDLGCKWVIVGHSERKATHFETAASVADKARIAVAAGLT
PIVCLGESKEMREAGQALHNIDIQLQPILEVGPDLIRSCVFAYEPIWAIGSGSIATSEQI
FEMHSHIRRQIQSVTGQEGSPVRIIYGGSVKADQARELFSLDCVDGALVGGASLDAEEFL
SIIDAAS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcagcattcaagctaaccattcacttatgctttctattttagatgggatatca
ttgtggtctttacctataaaacaagaggtcgtagtttgcccgccgtttccatatcttcag
caaattcgcgatattttagctttagaagcggaagaggcttttgatccgatttctcttggt
gcacaggatttaagtgtttacgaaaacggtgctcatacaggtgatgtctcagctcagatg
cttacagatttaggatgtaagtgggttatagttggtcattccgagcgaaaagcaacgcat
tttgaaactgctgcttcagtagccgataaagcccgtatagctgttgctgcgggactaact
cctatagtatgtttaggtgaaagtaaggaaatgcgtgaagctggtcaagcattacataat
attgacattcagcttcagccgattcttgaagtagggcctgatttgattaggtcatgcgtt
tttgcttatgaacctatttgggcgattggatcgggaagcattgccacaagcgagcagatt
tttgagatgcactcgcacattagacgtcagattcaatctgtgactgggcaagagggttca
cccgttcgcattatttatggtggtagtgtaaaggcggatcaggctcgagagttatttagt
cttgattgtgtagacggagctttagttggtggtgcttcactagatgctgaagaatttttg
agcattatagatgccgcatcttaa

DBGET integrated database retrieval system