KEGG   Taylorella asinigenitalis MCE3: TASI_0548Help
Entry
TASI_0548         CDS       T01634                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TASI_0548
   00240 Pyrimidine metabolism
    TASI_0548
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TASI_0548
   03430 Mismatch repair
    TASI_0548
   03440 Homologous recombination
    TASI_0548
Enzymes [BR:tas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TASI_0548
DNA replication proteins [BR:tas03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     TASI_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(543966..544421)
Genome map
AA seq 151 aa AA seqDB search
MAEIFVAHGARSIEDTLIMSVNSVSKQHQKGQSILVFCRDVNIATKFSEGLWGIDKTTFI
PHYFAGDEMIIPARIVICDEDIAKWASKLNPKPNLLINLSEDFIEDISLFPMVLEFVLND
SKSKEMGRARLQKYKAAGHVIKFHEFKYKKN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaatttttgttgctcacggggcaaggagcatagaagacactcttattatgtct
gtaaactccgtgagtaagcaacaccaaaagggtcaaagcatattggtattttgcagagac
gtaaatattgccacaaaatttagtgagggattgtggggtattgataagaccacatttatc
ccccactatttcgcaggggatgagatgattatccccgcacgcatcgtaatatgcgacgag
gatatcgctaaatgggcctctaagcttaatccgaagccaaacttgctcataaatctaagc
gaggattttattgaggatatatctctatttcccatggttcttgaatttgttctaaatgac
tccaaatctaaggaaatgggtagagcacgtttacaaaaatataaagctgcgggccatgta
attaaatttcacgagttcaaatataagaaaaattaa

DBGET integrated database retrieval system