KEGG   Taylorella asinigenitalis MCE3: TASI_0627Help
Entry
TASI_0627         CDS       T01634                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00010  Glycolysis / Gluconeogenesis
tas00620  Pyruvate metabolism
tas00640  Propanoate metabolism
tas00680  Methane metabolism
tas01100  Metabolic pathways
tas01110  Biosynthesis of secondary metabolites
tas01120  Microbial metabolism in diverse environments
tas01130  Biosynthesis of antibiotics
tas01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0627
   00620 Pyruvate metabolism
    TASI_0627
   00640 Propanoate metabolism
    TASI_0627
  Energy metabolism
   00680 Methane metabolism
    TASI_0627
Enzymes [BR:tas01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TASI_0627
Lipid biosynthesis proteins [BR:tas01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TASI_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AEP36401
UniProt: G4QAU1
Position
complement(626448..627857)
Genome map
AA seq 469 aa AA seqDB search
MEEKTKSDMHSTLFKEYEWYVPSNFNIASACCHRWASSPHEARLAAIYFEDQVGQLTSLS
YGQLSEKVNKLANGFVRMGIHPQDRIAIALQHSAETAITILAAITVGAIAVPLGISEDSQ
YYANRLIDCGARIAIVDKHSFTPFLHAVDHSSQLKNSLKQIIGINTEDERLIPWKALLAR
QPKDFNVIPVRPDTTAILLYPNVGTEAESSRKKKISDSLSEVSELKATVISHETLIGGLP
GFTCSQDWFPQNKDIFFTTYDWSSYYGLMGGLLPTLYFGRTIVGCPGGRTVPRLLSLIEH
YPVTNFFTSPEELERIRAFSGVLSKCDSGLRCVSTIAQGCSPALEFWLRESTNFKFNKLL
MPQGFSSIISESNAKWPSVPGSVGKAVPGYELAVLDPKGNKVKTNSFGTLHVKETDKNDD
SSPGVCTLYWHSNFLHPVPIINDQWFNTGIEIKVDKNGYYWLRDSNKGN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaacaaaatctgatatgcactctactttatttaaagaatatgagtggtat
gtcccatctaatttcaatattgcttctgcttgctgtcatagatgggcctccagtccgcat
gaagctagattagcggctatatattttgaagatcaggttggtcaactaactagtttatct
tatggtcaactatccgagaaagtgaataaattagcaaatggttttgtaaggatgggaatt
catccacaggatcgcattgccatagcacttcaacattcggctgaaactgcaattacgatt
ttggcggctataactgtaggtgcaatagctgttccattaggtataagtgaagattctcag
tattacgcaaatagattaattgattgcggggctcgaattgctattgtagacaagcattct
ttcacaccgtttttacatgctgtcgatcattcgtcacaacttaaaaattcgcttaaacag
ataattggtattaatacagaagatgagcgattgataccttggaaagcattgctagctcgc
caaccaaaggattttaatgtcattccagttaggccagatactacggccatacttctttat
ccaaatgttgggactgaggctgaaagttcaagaaagaaaaaaatttcagactcgctatct
gaagtttcagaacttaaagctactgttatatctcatgaaactttaattggtggtctacct
ggattcacctgctcacaagattggtttccgcaaaataaagatatattttttaccacttac
gattggagcagttattacgggttgatggggggattattgccaactttatattttggcaga
actattgtaggatgccctgggggacggactgttcctagattattatcattaatagagcac
taccctgtgaccaatttttttacttcaccagaggagttggaacgtataagggctttttca
ggggttttatctaaatgcgactcaggtcttcgttgcgtatcaactattgctcaaggatgc
agtccagctctagagttttggcttcgcgaatccactaattttaaattcaataaactttta
atgcctcaaggtttctcttcaatcatctcagaatcaaacgccaagtggccgtcagttcca
ggaagcgtaggtaaagcagttcctggatacgaattagccgttttggaccctaaaggaaac
aaagtcaaaactaattcttttggcactttacatgttaaagaaaccgataaaaacgatgat
tctagccctggtgtctgtacgctttattggcattccaattttcttcatccagtgcctatt
attaatgaccagtggtttaatactggcatcgaaatcaaagtggataaaaacggatattat
tggctaagagactcgaacaaaggaaactga

DBGET integrated database retrieval system