KEGG   Taylorella asinigenitalis MCE3: TASI_0749Help
Entry
TASI_0749         CDS       T01634                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tas00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756128..756820
Genome map
AA seq 230 aa AA seqDB search
MPALKIMPLIPPQDILSLDLISSLQYIFFVSKNAVAIFFKNFEKYAKALPTQIKFLCVGP
GTASEIRKYSAADAEIIFPENDVHDSYSLYLKIHKLVRPNSKILIVKGEGGREFFKTAMS
KDGHEIYELEIYKRLSKDYSGQEMLIFSNLDSQDDLAILFTSPDGIRGLMPQLEKYCEPE
LLKRTLYLILHENHRDLLPNKKCEIVSLEANIIHAKLASIFEPMKYNIKH
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcactcaaaataatgccgttaatacctcctcaagatatcctatcattggattta
ataagttcactgcaatatattttttttgtaagtaaaaacgccgtagcaattttttttaaa
aattttgagaaatatgcaaaggcattgccaactcaaattaaatttctatgcgtaggccct
gggacggcaagtgaaataagaaaatattctgcagcagatgcggaaattattttccctgaa
aatgatgttcatgattcttattcattatatttaaaaatccataaacttgtcagacccaat
agtaagattcttatcgtaaagggagagggtggtcgtgaattctttaaaactgctatgtct
aaagacggtcacgaaatctatgaattagaaatttataaaagacttagcaaggactattcg
gggcaagagatgttaattttttctaatttggactctcaagatgatttagctattctgttt
acgagtcctgatgggattagggggctgatgccacaattagagaaatactgtgagcctgaa
ttgcttaaaagaaccctatatcttattttgcatgaaaatcatagggacttattgccaaat
aaaaaatgtgaaattgtgagtctagaagcaaatataattcatgcaaaattggcctcaata
ttcgaacctatgaagtacaatattaaacattaa

DBGET integrated database retrieval system