KEGG   Taylorella asinigenitalis MCE3: TASI_0792Help
Entry
TASI_0792         CDS       T01634                                 

Definition
beta N-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TASI_0792
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TASI_0792
Enzymes [BR:tas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TASI_0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796409..797467
Genome map
AA seq 352 aa AA seqDB search
MAGPVIVDIEGFELNDRERVRLQHPLVGGMILFSRNYKNPGQLQKLTAQIREARAAAKDP
KVGRSKILITVDHEGGRVQRFKTEGFTHIPAMASLGCIYDQDPLRAIRIATETAYVMAIE
LLSCGVDFSYTPVLDLNYGVSSVIGDRSFHRDPKIVSILSRAFVQGLAKAGMSCCGKHFP
GHGFVEADSHIAIPEDNRTLDEILGEDVKPYEWLGDLVLPSVMLAHVIYKKVDKHNACFS
KVWIQDILRSKLGYDGLIFSDDLTMEGASYIGDITARGQAALDAGCDMVMVCNKPDLADE
LLANLRYNPNQNPHLERRLEELYPKYKVCSWENLGQNVAYKNARSATDKVFS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtcctgtaattgttgatattgagggttttgaattaaatgaccgtgagagagta
cgcctgcagcatccccttgttggtgggatgattttattttcaagaaattataaaaatcca
ggccagttacaaaaattaacggctcaaatacgtgaagccagggctgcagccaaagatcct
aaagtgggtagatctaagattcttataaccgttgatcatgagggtggtagggttcaacga
ttcaaaacagaagggtttacacatatcccagctatggctagcctaggctgtatctatgat
caagatcctttaagggccatacgcattgccacagaaactgcatatgtaatggctatagag
ttgttatcatgtggcgtcgatttttcctatactcctgtattggatttaaattatggagtt
agttcggtaataggggataggtcatttcatagagatccaaaaattgtctcgatattatcg
cgtgcatttgtgcaagggctagctaaagcaggaatgtcttgctgtgggaagcattttcct
gggcatggctttgtagaagcggattcacatatcgccatacctgaagataatcgcacactt
gatgaaattttgggtgaagacgtgaagccatatgaatggctgggcgacttggtattgcca
tcagtaatgcttgctcatgtaatttataaaaaggtagataagcacaatgcatgcttctca
aaagtttggattcaagatattttacgcagcaagcttggatacgatggtttgattttttcc
gatgacttaactatggaaggtgcaagttatataggagatattacagctcgcggtcaagca
gcattggatgcagggtgtgatatggttatggtatgtaataagcctgacttagccgatgaa
ttgcttgctaatttgagatataaccctaatcaaaatccccatttagagcgaagattagaa
gaactttatcccaaatataaagtttgtagttgggaaaacttagggcaaaatgtagcttat
aaaaatgcaagatccgcaacagataaagtcttttcttaa

DBGET integrated database retrieval system