KEGG   Taylorella asinigenitalis MCE3: TASI_0902Help
Entry
TASI_0902         CDS       T01634                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00010  Glycolysis / Gluconeogenesis
tas00020  Citrate cycle (TCA cycle)
tas00620  Pyruvate metabolism
tas01100  Metabolic pathways
tas01110  Biosynthesis of secondary metabolites
tas01120  Microbial metabolism in diverse environments
tas01130  Biosynthesis of antibiotics
tas01200  Carbon metabolism
Module
tas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TASI_0902
   00020 Citrate cycle (TCA cycle)
    TASI_0902
   00620 Pyruvate metabolism
    TASI_0902
Enzymes [BR:tas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TASI_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H CAT RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEP36671
UniProt: G4Q9Q5
Position
complement(910913..912325)
Genome map
AA seq 470 aa AA seqDB search
MSQLVEVKVPDIGDFDDVSVIEVLVKEGDSISENDSIITVESDKASMEIPSSASGVIKSM
RVKLGDKVSEGVVLLTLEPSDKDDSSKDTKEEPKVEAASEPKEPKEQTEPKSKSSKEEAT
ALPPESEHKQSSKTYIAQSSDAGDKVGKTKESPTAAFALSGKEIRNLPHASPSVRQFARS
LGVDLSQVKGTGRKSRIVLDDVRNFVKSALSAPGGITTGSSTLGGSGLSLLDWPKVDFAK
FGEVDTKPLSRIKKISGANLHRNWVMIPHVTNNDEADITDLEAFRVQLNKEYEKAGTKFT
MLAFIFKAVVQALKKFPEFNASIDGENLVYKKYYHIGFAADTPNGLVVPVIKDADKKSVS
DIAKETAELAKLARDGKLSPTQMQGGCFTISSLGGIGGTHFTPIINAPEVAILGVSRSFQ
KPVWDGKEFKPRLTLPLSLSYDHRIIDGAAAARFNAFLSQLLSDFRRALI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaattagttgaagtaaaagttccagatataggtgatttcgatgatgtttcagtt
atcgaagttttagttaaagagggtgattcaatttcggaaaacgacagcataataactgtc
gaatctgataaagcttctatggaaataccaagtagtgcatcgggggttatcaaatcgatg
cgtgtaaagcttggggacaaggtaagtgaaggtgtagtattgcttactcttgaaccttct
gataaagatgattcaagtaaggatacgaaagaggagccaaaggttgaagccgcctcagag
cctaaagagcctaaggaacaaactgaacctaagtcaaaatcatcaaaagaagaagcaact
gcattgccacctgaaagtgaacataaacaaagttctaaaacttatatcgctcaaagttct
gatgcaggggataaggttggaaagaccaaagaatcaccaacagccgcatttgctctttca
ggcaaagaaattagaaatcttccacatgcatcaccttcagtaaggcagtttgctagatca
cttggggtagatttaagtcaagttaagggtactggtcgtaagagtagaattgttttagat
gatgttagaaacttcgtaaaatctgctctctcagctcctggagggattactacaggatct
tctactttaggtggtagtggtttatctttgcttgattggccaaaagtggattttgctaaa
tttggtgaagtcgatactaagccattatcaaggattaaaaaaatctcaggtgcaaacctt
catagaaactgggtaatgatccctcatgttactaataatgatgaggcggatattacggat
ttggaagctttccgtgttcagcttaataaggaatatgaaaaagctggcactaaattcacg
atgcttgcatttatatttaaagcagttgtacaagcccttaagaaatttcctgaatttaat
gcgtctattgacggagaaaatttagtttataaaaaatactaccatataggctttgcggcc
gatactcctaatggtttggtagttccagtaattaaagatgcagataaaaaatctgtatcg
gatatagctaaagagactgctgaactagcaaaacttgctagagatggaaaattaagtcct
actcaaatgcaggggggatgttttacgatttcatctttgggtggcataggcggaactcac
tttacaccaattatcaatgctccagaagttgctattttgggtgttagccgttcttttcaa
aaacctgtctgggacgggaaggaatttaaaccaagattaactttaccgctttcgctttct
tacgatcacagaattattgatggtgcagcggcagctagatttaatgcgttcctaagtcag
ctattatctgactttagacgagctttgatttaa

DBGET integrated database retrieval system