KEGG   Taylorella asinigenitalis MCE3: TASI_0953Help
Entry
TASI_0953         CDS       T01634                                 

Definition
GTP cyclohydrolase I type 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tas00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(965734..966414)
Genome map
AA seq 226 aa AA seqDB search
MSQNTKYISDVIRERIQTAGKRFHANDNISEFINEDEIAQLQDEVESKFKAVLESLVIDT
ESDHNTNETAKRVAKMYVREIFAGRYEPMPAVTEFPNIESVNELIVVGPITIRSACSHHF
CPIMGQCWIGVMPHKDSNLIGLSKYARIAHWVMHRPQIQEEAIMQLAAILEQKLNPKGIA
VIMKADHYCMKWRGVKDSDSKMTNSVMRGCFLTNSDLRKEFLSLIA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaacacaaaatacatatcagatgttatacgcgagcgaattcaaacggcgggc
aagcgttttcatgctaacgataatatttctgaatttataaacgaggacgaaatagctcaa
ttacaagacgaagtagagtcgaaattcaaagcagtacttgagagccttgttatagatact
gaatctgaccataatactaacgagacagcaaaacgcgtcgcaaaaatgtatgtgcgtgag
atatttgcaggtcgctatgagccaatgccagctgtgacagagtttcctaatatcgaaagt
gtaaatgagctaattgtggttggcccaatcactataaggagtgcgtgctcacaccatttt
tgcccaatcatgggacaatgttggattggagttatgccgcataaagattcaaatttgatt
gggctatcgaaatatgcacgaatagctcattgggtaatgcatagaccgcaaatacaagaa
gaagctatcatgcaattagccgcaattctagagcagaaattaaatccgaaggggattgcg
gtgattatgaaggctgatcactattgcatgaaatggcgtggggttaaggattcagatagc
aagatgactaatagtgtgatgcgtggttgttttttgactaattctgatttgcgaaaagaa
tttttatccttaatagcctaa

DBGET integrated database retrieval system