KEGG   Taylorella asinigenitalis MCE3: TASI_0969Help
Entry
TASI_0969         CDS       T01634                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TASI_0969
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TASI_0969
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TASI_0969
Enzymes [BR:tas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TASI_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(987528..988955)
Genome map
AA seq 475 aa AA seqDB search
MKYISTRGGAQPAEFCDILIEGLASDGGLYVPESIPKIDITTLNSWVGLSYPEMAMEILP
LYITDIPKEDLSKIVNNTYNQSVFNNADIVPLKKFTFKGKENFYLLGLSEGPTIAFKDLP
MQLLGNLFEYVLSKRNTHVNILGSTSGDTGSAAEYAFKGKKGVQVFMLSPYGRMSEFQKS
QMYTLEDPNIHNLSVKGVFDECQDIVKAINGDLDFKKKHHIAAVNSINFARIAAQIVYYF
WAWCASAPRDDEKTNYQIDITVPTGNFGNILAAQIAKMMGLPLRNLIVATNENNVLEDFF
KSGVYKPRSPEQTYSTSSPSMDISKASNFERFVYFLLDCNSEKLNEYWAKLSSDGSFDLS
EYKDEIALRYAFKAGMSSHQDRIATIKGFYEQTAYTLDPHTADGVKVASEFMDTDTPMFV
AETALAAKFGPTIAEALGKPAAIPERFADLLDKKRHDIVMDNSVDAVKEYIASHA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatatatctactcgaggtggtgctcagccagcagaattttgcgatattttgatt
gagggtctagcttctgatggtgggctttatgttcctgagagtattccaaaaatagatata
actacattaaatagttgggtgggattatcgtatcctgagatggctatggaaatattgcca
ctttatataacggatattccaaaagaggatttatccaaaatagtaaataacacttacaat
caaagtgtttttaataatgcagatatcgttccacttaaaaaattcacctttaaaggaaaa
gagaacttttatcttttaggcttatcggaagggcctaccattgcgtttaaagatttacca
atgcaattattaggaaatcttttcgaatatgttctttctaaacgaaatactcacgtcaat
attttaggctcaacatctggagacactggctctgcggctgaatatgcatttaaaggaaaa
aaaggcgttcaagtatttatgctatctccttatggtcgcatgagtgaatttcaaaaatca
cagatgtatacacttgaggatccgaatattcataacttatctgtaaaaggtgtttttgat
gaatgtcaggatatcgtaaaagccattaatggtgatttagactttaagaaaaaacaccat
atcgcagcagtgaattcaattaattttgcccgtattgcagctcagattgtgtattatttc
tgggcttggtgtgcgagtgcacctagagatgatgaaaaaaccaactaccaaattgatata
accgtcccaacagggaatttcggaaatattcttgcagcacaaatcgctaagatgatggga
ctacctctaagaaacctaatcgtagctactaacgagaataatgttcttgaggatttcttt
aaatcaggtgtttacaagcctcgcagccctgagcagacatattcgacttcaagtccatcc
atggacatatcaaaagcgtctaatttcgagcgctttgtttatttcttgctcgattgcaat
tcggaaaaattaaatgagtattgggcaaaacttagttctgatggtagtttcgatttatcc
gaatataaggatgagatcgctttgagatatgcgtttaaagcaggtatgagttcacatcag
gatcgcattgccacaattaagggattttacgagcaaacagcttatacgcttgacccacac
acagcagatggcgttaaagtggcttctgaatttatggacacggatacgcctatgtttgtt
gctgaaactgcattggctgctaaatttggaccgaccatagcggaggctttaggtaagcct
gcagcgattcctgagcgatttgctgacctgctcgataaaaagcgtcatgatattgtgatg
gataattctgtcgatgctgtgaaggagtatatcgcttcacatgcgtag

DBGET integrated database retrieval system