KEGG   Taylorella asinigenitalis MCE3: TASI_0974Help
Entry
TASI_0974         CDS       T01634                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00230  Purine metabolism
tas01100  Metabolic pathways
Module
tas_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TASI_0974
Enzymes [BR:tas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TASI_0974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_23 ABC_tran AAA_33 DUF87 AAA_29 AAA_22 AAA Adeno_IVa2 AAA_16
Motif
Other DBs
NCBI-ProteinID: AEP36735
UniProt: G4QBB4
Position
993001..993633
Genome map
AA seq 210 aa AA seqDB search
MEFPGNVFLISAPTGAGKSSLVKALIERNPFINLSISYTTRTPREGEVDGREYFFISKEQ
FSDWREQGNMLEWAEVYGNFYGTAKSQVESVISTGQDVLLEIDYQGARQIRKKFPGIIDI
FILPPSIDELEKRLLKRGLDSPEVIRKRMLTVSSEIGHADEYSYVIINDSFETALDQLDT
LVKAAKLKYASQANKHQALFADLGISYLPK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaatttccaggaaatgtttttttaatttcggctccaactggagctggtaaatcgagt
cttgtaaaagcactaatcgagagaaacccttttataaatctctcaatttcatataccact
cgcactcctcgtgaaggtgaagtcgatggacgagaatattttttcatcagtaaagagcag
ttcagtgattggcgtgagcagggcaatatgctagagtgggccgaagtttacggaaacttt
tacggtacagctaaatcccaggtggaatcagtaatctctacaggacaggacgttttgctt
gagattgactaccaaggagcacgacaaataagaaaaaaatttcctggaattattgatata
tttattcttcctccctccattgatgaattagaaaaacgccttcttaaaagagggcttgat
tctccagaggtaattcgcaaaagaatgcttaccgttagcagtgaaattggacatgctgac
gagtactcctatgttataataaacgattcttttgagactgccttagatcagctagatacc
ttagttaaagcagctaaactaaagtatgcaagtcaagcaaataaacatcaagccttgttt
gctgatttaggaatttcctatctgcctaagtag

DBGET integrated database retrieval system