KEGG   Taylorella asinigenitalis MCE3: TASI_0982Help
Entry
TASI_0982         CDS       T01634                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TASI_0982
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TASI_0982
  Amino acid metabolism
   00310 Lysine degradation
    TASI_0982
Enzymes [BR:tas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TASI_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1002733..1003980)
Genome map
AA seq 415 aa AA seqDB search
MSIVNVVVPQLSESVSEGTLIEWKYKVGDQVSVDDILVEIETDKVVLEVPAPSAGVITEI
LESDGATVTPDQVLAKIDSEAKAEAKTAPKEEAPKEAAPKEQAKEPAAAAKSDDSAAQKS
GSKGDIASPAARNILAEKDMKASDVAGSGRDGRVTKSDAMGASKGASKAESKSSAPMSTN
TEGRIEERIPMTRLRARVAERLIQSQQQNAILTTFNEVNMKPVMDLRAKYKEAFEKEHGI
KLGFMSFFVKAAVHGLKKYPILNASVDGNDIVYHGYFDIGVAVSSPRGLVVPIIRNADQL
SFADIEKTIAEFGQKAKEGKLGLDDLTGGTFTVSNGGVFGSMMSTPIINPPQSAILGIHA
TRERAVVENGQVVVRPVNYFALSYDHRIIDGREAVLGLFAMKEALEDPQRLLLNL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgttaatgtagtggtaccacagctgtctgagtcagtttcggagggtactctt
atcgaatggaaatataaagtaggtgatcaagtatctgtagatgatattttggttgaaatt
gaaacagataaagttgtgcttgaagttcctgctccgtcagctggtgttattactgagatt
cttgagtctgatggtgcaactgttacaccagaccaagttttagcgaaaatcgattctgaa
gctaaagcagaagctaagacagctcctaaagaggaagctccaaaagaagcagctcctaaa
gagcaagcaaaagaacctgctgcagcagcaaaatctgacgattcagcagctcaaaaatca
ggttcaaaaggagatatcgcttcccctgcagctcgcaatatcctagctgaaaaagatatg
aaagcttctgatgttgcaggttcaggtcgcgatggtcgagtgactaaatctgatgcaatg
ggtgcttctaaaggtgcatctaaagccgaatctaaatcatctgcacctatgtctactaat
acggaaggtcgcatcgaagagcgcattcctatgacacgtttgcgtgcacgtgttgctgag
cgcctaattcaatctcaacaacaaaatgcaattcttactacttttaatgaggtaaatatg
aaaccagttatggaccttcgtgcgaagtataaagaagcattcgaaaaagagcatggtatt
aagcttggctttatgtctttctttgtgaaagcagctgttcatggccttaaaaaatatcca
atccttaacgcttctgtcgatggcaatgatatcgtataccacggttattttgatatcggc
gttgcagtatctagccctcgtggtttggttgttcctattatccgtaatgccgatcaacta
agctttgctgatattgaaaaaactatcgctgaatttggtcaaaaagcaaaagaaggtaag
ttaggtctggacgatttaacaggtggtacattcactgtttcaaacggtggcgtgttcggt
tcaatgatgtctactccaatcattaacccaccacaatcagcaattttaggtattcacgca
actcgcgaacgtgctgttgtagaaaatggtcaagtagttgtacgtccagttaattacttt
gctctttcttatgaccacagaatcattgacggtcgtgaagctgttcttggcttatttgct
atgaaagaggctttagaagaccctcaacgtttattgttgaacctataa

DBGET integrated database retrieval system