KEGG   Taylorella asinigenitalis MCE3: TASI_1022Help
Entry
TASI_1022         CDS       T01634                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TASI_1022
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TASI_1022
   00650 Butanoate metabolism
    TASI_1022
  Energy metabolism
   00190 Oxidative phosphorylation
    TASI_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1041282..1041656)
Genome map
AA seq 124 aa AA seqDB search
MPDQFGTNRRAVGAHYGTIGFIVQRLTATLLAIYSVFFLLTLLFTPVTYENWLHLFTFTV
LSIPAGQICVTLVFFTLSWHAWIGIRDVWMDYIDCWKLRLILFIFTIFWLIAMSIYFSFV
VWSL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatcaatttggtactaatcgtcgtgcagtaggagctcattacggaacaattgga
tttattgttcaacgtttaactgctactcttttagcaatttattctgttttctttctcctc
acattgttatttacaccagtaacttatgagaattggttgcaccttttcacttttactgtt
ttgagtatccctgctggtcaaatctgtgtaactttagtgtttttcacactttcatggcac
gcatggattggaattcgtgatgtttggatggactatatcgattgctggaagcttcgtcta
attctatttatatttacgatattttggcttattgccatgtctatttatttctcatttgtc
gtttggagtctttaa

DBGET integrated database retrieval system