KEGG   Taylorella asinigenitalis MCE3: TASI_1130Help
Entry
TASI_1130         CDS       T01634                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:tas03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1158141..1159094
Genome map
AA seq 317 aa AA seqDB search
MPELPEVEVTKQDMNDMILGSENSPKSKTIAYALPYTKEFYSAKTNPKNNKRDFIAQILD
YENRRKLLSDAQILSIERIAKFIIISTNIGLHIIVHLGMSATIYPIIATENDKELIASGR
GLDFLSLLNTSTDRVFAKHHHTGFLLEDGRIFLFHDVRRFGEWAILNDQELADFKNSFIS
SWDPHLSDFDPKSLINFIQNHPIQSTKKWVNSKMNLLAFIGKSGAIKGCGAIYSREVIYE
SGIEPSTPICLLKNKDWTKIANAMRDVLSESIMDGGTAFNTKESDKADLVRARGDFVRPS
GVLSRYQEKLKSYKKKH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacttccagaagtagaagtcacaaaacaagatatgaacgatatgattttggga
agcgagaatagcccaaaatcgaagacaattgcgtatgcattgccatatacaaaagagttt
tactctgcaaaaacaaatccaaaaaataacaaaagagattttattgctcaaatattagac
tacgaaaacagacgcaagcttttatctgatgctcagattttatcaattgaaagaatcgcc
aaatttataattattagcacaaatattggtttgcatattattgtccatctaggcatgtca
gcgacaatttacccaatcattgccacagaaaacgataaggaactgattgcttcgggcaga
ggacttgattttctctcattgttaaatacttctacagacagagtatttgcgaaacatcat
cacactggatttttgctcgaagatggtcgcatattcttatttcacgatgtacgaagattt
ggagaatgggctatattaaatgatcaagaattagcagacttcaagaatagttttatatcc
tcttgggatccgcacttatctgactttgaccccaaatctcttataaattttattcagaat
catccaattcaatcgacaaaaaaatgggtaaattcgaaaatgaatttactagcttttata
ggaaagtcgggagctatcaagggatgcggagcgatttattctcgagaggttatatatgaa
tctggcatcgaacctagcacaccaatttgtttattaaaaaacaaagattggacaaagatt
gctaatgctatgcgtgatgtacttagtgaatcaattatggacggtgggactgcatttaat
acgaaagagagtgataaagcagatctcgtgagagctagaggtgattttgtaagacctagc
ggtgtcctaagccgatatcaagagaagcttaaatcttataaaaagaaacactaa

DBGET integrated database retrieval system