KEGG   Taylorella asinigenitalis MCE3: TASI_1224Help
Entry
TASI_1224         CDS       T01634                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tas00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TASI_1224
DNA repair and recombination proteins [BR:tas03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TASI_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1266567..1267163)
Genome map
AA seq 198 aa AA seqDB search
MTREPEPLQALVDSIANLPGIGVRTARRLAYHLLQHDRSGAEYLAINLQRALQTLKHCHK
CNNFSSTDICDICASSKRDASLLCVVETPADLVRIEESHGFNGLYFVLMGRISPMSSKGA
QGLNFEHLIERVKDSDVREVIIATNFTAEGETTAHFIKTFLTEMGINTSRIARGVPSGSE
LEYVDAATIAWALNDRKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgactcgagaacctgagccactccaagcacttgtagattcaattgcgaatttaccaggt
attggtgttagaaccgctaggagactggcttatcacctattacagcacgataggagcggg
gcagagtatcttgctataaatcttcaaagggctttgcagacacttaaacattgccacaaa
tgcaataatttctctagcacggatatatgtgatatttgtgcatcaagcaaaagagatgcg
tctcttttatgcgtggttgagactcctgcggatttggttcgcattgaagagagccatgga
tttaatgggctatattttgttttgatgggcaggatatctcctatgtcatctaaaggtgca
caagggcttaactttgaacatttaattgaaagagttaaggactcggatgtaagagaggta
atcattgccaccaactttacggctgaaggtgagactacagctcattttattaagacattt
ctgactgagatgggtattaatacatcacgaattgctaggggtgtaccaagtggcagtgag
cttgaatatgttgatgctgccactattgcatgggctttaaacgatagaaagaaatag

DBGET integrated database retrieval system