KEGG   Taylorella asinigenitalis MCE3: TASI_1242Help
Entry
TASI_1242         CDS       T01634                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tas00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1287206..1287697
Genome map
AA seq 163 aa AA seqDB search
MHKVFIGLGANLGDELSYINKAISKLVECDDIELLATSSVYKTSPVESDGEDYLNAVIQI
NTSLDPFELLSIMQKIELDLGRQRPYKNAPRTIDLDILLFDDMQIKGDRLTIPHPRITQR
AFVLVPLRELNPDLEIGGQSLETWIANLPCDQKIEKTTYSLNP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgcataaggtttttataggtctgggagcgaatctaggcgatgagctttcgtatatcaat
aaggcgatatcaaagcttgtagaatgcgatgatatcgagcttttagcaacttcaagtgtt
tataaaacaagtcctgtagaaagcgacggtgaagactatcttaatgccgttattcaaata
aatacctcactagatccatttgaattgctttcgattatgcaaaaaatagagttggaccta
ggccgtcaaagaccctataaaaacgcaccccgtacaatcgatttagatatattgttgttt
gatgatatgcaaataaagggcgatagactcacaataccgcatcctcgtatcacacaaaga
gcttttgttttagtgcctctaagagaactcaatccagatttagaaattggaggacaatcg
cttgagacttggattgcaaatctgccatgtgatcaaaaaatcgagaagacaacttactct
ttaaatccataa

DBGET integrated database retrieval system