KEGG   Taylorella asinigenitalis MCE3: TASI_1243Help
Entry
TASI_1243         CDS       T01634                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TASI_1243
   00052 Galactose metabolism
    TASI_1243
   00500 Starch and sucrose metabolism
    TASI_1243
   00520 Amino sugar and nucleotide sugar metabolism
    TASI_1243
Enzymes [BR:tas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TASI_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1287679..1288473)
Genome map
AA seq 264 aa AA seqDB search
MPITKALPKEMLPIIDKPLLHYAVKEAVDAGIEDLIFIVGGNRQSIEDYFDRNLLLESKL
REEGKEDLLRMVEEIVPSNVNCIFIRQHAPIGLGHAVLQARPAIGDEPFAVLLVDDLFYC
EEQEPSALQKLINTYFETRSTVIATHEVERDIIQNYGVIEGILDSETGSYVLSDIIEKPN
PSLAPSNMAILGRYVLEPDIFESLRQTQPGKNGEIQLTDGIGRLLKSKQVRALPITNLHF
DCGSKEGWYRANMFYGRKVYGFKE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgcctataacgaaagcattgccaaaggagatgctaccaataatcgacaagccacttttg
cattacgctgtaaaagaggccgtggatgcgggtatcgaggatttgatttttattgtgggc
ggtaatcgacaaagtatcgaagattattttgatagaaatctattgctcgaatcaaagctt
agggaagagggaaaagaggatttgcttcgcatggtagaggaaattgttccttcaaatgtg
aattgtatttttattcgccaacatgcaccgataggcctagggcatgcggttcttcaagct
agacctgcaattggggatgagccgtttgcggttttgttagtggatgatttgttttattgt
gaagaacaggagccttctgcgttacaaaaattgattaatacctattttgagacgagaagc
acggtcattgccacccatgaggtggagcgggacataattcaaaattacggtgttatcgag
ggcattttagatagcgagacaggaagctatgttttaagtgatattattgagaagcccaat
ccaagccttgctccatcaaatatggctattttgggacgttatgtgctagagcctgatatt
ttcgagagtttgcgtcagacgcagccaggaaaaaacggggaaatccaacttacagacggt
attgggaggctactgaaaagtaagcaagtcagggctttacccatcactaatcttcacttt
gattgcggctctaaagagggatggtatagggccaatatgttctatggtcgtaaagtttat
ggatttaaagagtaa

DBGET integrated database retrieval system