KEGG   Taylorella asinigenitalis MCE3: TASI_1259Help
Entry
TASI_1259         CDS       T01634                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tas00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TASI_1259
Enzymes [BR:tas01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TASI_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1299833..1300408
Genome map
AA seq 191 aa AA seqDB search
MISRLKGKLISKFPPTVCIDLGGIAYDVDVSMTTFYELPDIGQEVTLYTHLAVREDAHTL
YGFISEEERATFRALVKVNGIGFKSALGILSGMTPDALYSAIESEDSSQLERVPGIGKKT
AARILLELKGKMPELGSSSDKSSNSKNHNDILAALLNLGYSDKQAKQAISALPKDIDATE
GVRIALRSMDK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgattagtcgtttgaaaggaaaattaatctcgaaatttccgccaactgtttgcattgat
ttaggcggtattgcctatgatgtagacgtttcgatgactacattctatgaacttcctgat
attggtcaggaggtgactctttatacgcatcttgcagtgagagaggatgctcatacttta
tatggttttatttctgaagaggaaagagcaacttttagggccttagtcaaagtaaatggt
attggatttaaaagtgctttgggcattctctcagggatgaccccagatgcactctatagt
gctattgagtctgaagattcatctcaacttgaaagagttccaggcatcggaaagaaaaca
gcagcacgaatattgcttgagctaaaaggaaaaatgcctgagttaggtagcagctcagat
aaatcttcaaactcaaaaaatcataacgatatacttgcagctttactaaatcttggctat
tcagataaacaagctaaacaggctataagtgcattgcctaaggatatagatgctactgaa
ggtgtgcgtatagcattgcgttctatggataagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system