KEGG   Taylorella asinigenitalis MCE3: TASI_1286Help
Entry
TASI_1286         CDS       T01634                                 

Definition
murein biosynthesis bifunctional protein
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TASI_1286
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TASI_1286
Enzymes [BR:tas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     TASI_1286
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TASI_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1329966..1332698)
Genome map
AA seq 910 aa AA seqDB search
MNEILNWLKEHVEPDADLRLDSRDIQKGDVFVACKGYKGDGYAYVNDAINNGASAILLEG
NEGSETLALPHLVVPNLRQKLGLIADAWYGSPSSKIAVIAITGTNGKTSCAHWIAQALNA
SNIPCATIGTLGTILPSGENLGGQLTTPDVLSVHRILAQLVKRDIEVVSIEASSIGIEQG
RLDNVQIKIACFTNLSLDHLDYHKSMKEYEEAKTQLFRNELLEHAIINLDDEAGRRIFDS
SLAKSNIGYSVKLNPRAQIQASDQEFHDYGLSFHIKMPEGSCQVITRLVGAHNISNLLVL
AGVLNCLDFSVEKIVEIIATIKPVSGRLEVVKIHQASKADRSNLPLVVVDYSHTPDALLN
ALTALRSTTDARKGNLICVFGCGGDRDKTKRPIMAEVASKNSEIVYITSDNPRTEDPCSI
INETLLGMDRYAFSHTDRAYSILHAILNAKNEDVILIAGKGHENYQEIQGVKHKFNDAHW
ASIALLLKAGFKINTDSRTLQQNEIFLALKGDVFDGHDFVNSLNCMGAIVDHKVTDASVK
QYIVDDTTEALGIISKAWRSQFNIPIIAVCGSNGKTTCKEMIASILKEQFGEQSFFATQG
NLNNHIGVPKSLLSLQSTHKIAVLELGMNHPGEISYLANLVKPTIALVTNAQREHQEFMK
TVEAVARENGSVFEELDSNGVAIYPNDTAYKNIWTSQSKHCKSITFGDAGVIKAKDINID
ENGTSFKVDLDRGHLDINLSILGEHNIQNALAAIAAAVAAQVDLKAIENGLKNFQPVKGR
LQKHILKDGVIVVDDTYNANPDSVIAAINILKTLPAPRTLVLGDMGEVGEDSLQMHSEIG
RYAKASGIEHLLSIGEASAHAQNSFGNVHAHFSNIEDLIEKLKSLNSKSIIIKGSRFMKM
ERVLEALTKD
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaattttaaattggctgaaggagcacgtagaacctgatgcagatctacgactt
gatagcagagacatccaaaaaggggatgtctttgtcgcttgtaaagggtataaaggcgac
gggtatgcctatgttaatgatgcgataaacaatggagcttcagcaattttgcttgagggt
aatgaagggagcgaaacgttagcattgccacatttagttgttccgaatcttcgtcagaaa
ttgggactaattgcagatgcgtggtacggtagcccttcttcgaaaatcgcagtaattgca
attacgggcacaaatggtaaaacatcatgtgctcattggattgctcaagccttaaatgct
agtaatatcccatgtgcaactatcggaacattaggtactattttgccatctggagaaaat
ttgggtggtcagttgactactcctgatgtattaagtgtacatagaattcttgctcaactt
gtaaagcgagatattgaagtagtctccatagaggcatcatctataggtattgaacagggc
cgattagacaatgttcaaattaaaattgcttgctttactaacttatctttagatcatttg
gactatcataagtccatgaaagagtatgaggaagctaagacacagctttttagaaatgaa
ttattagagcatgcgattataaatttagatgatgaagcaggacggagaatcttcgattct
agccttgctaaatcaaatatcggatatagtgtaaaacttaatccaagagctcagatacag
gcttcagatcaggagtttcatgattatggcttatcatttcatatcaaaatgcctgagggg
tcttgtcaggttataactcgcttagtcggagcccacaatatatcgaatttattagtgcta
gctggggtgctgaattgtttagattttagtgtcgaaaaaattgtagaaattattgcgaca
ataaagccagtttcaggtcgtcttgaagtagtaaaaattcaccaagctagcaaagctgat
cgttcaaatttacctttggttgttgtagattattctcatacaccagatgcactattaaat
gcattgacagctctaagatctacgactgatgcacgtaaaggtaatcttatatgtgtgttt
ggatgtggtggtgatagagataaaacaaaacgcccaattatggcggaagttgcctcaaag
aattctgaaattgtttatataactagcgataatcctagaactgaggatccatgctccatt
attaatgagacattacttggtatggataggtatgctttctcgcatacagatagggcatac
agcatacttcatgcaattcttaacgcaaaaaacgaagatgtaattttgattgctggaaaa
ggtcacgagaattatcaagaaatacaaggcgtcaagcataagtttaatgatgcacattgg
gcgagtatagctttacttttaaaagcaggatttaaaatcaataccgattcaagaacctta
cagcaaaatgaaatctttctagctttgaagggcgatgtattcgatgggcatgattttgtt
aattctctaaattgcatgggagctattgttgatcacaaagttacggatgcctcagtgaaa
caatatattgttgatgacactaccgaggctcttggaattatttctaaagcttggagatcg
caatttaatattccaattattgctgtttgtggtagtaatgggaaaaccacatgtaaggag
atgatagcttcaattctcaaagagcaatttggagaacaatctttctttgcaactcaggga
aatttaaacaatcatattggtgtccctaaaagcttattgagtctgcagtccactcataaa
atcgctgtcttagaattgggtatgaatcatcctggagagatttcatatctagctaattta
gttaagcctactatcgcactcgttaccaacgctcaaagagaacaccaagaatttatgaaa
actgttgaagctgttgctagagaaaatggtagtgtttttgaggaacttgattctaatgga
gttgcaatatatccaaacgatacggcttataaaaatatttggacttctcaatcaaaacat
tgcaagtctataacatttggagatgcaggagtaatcaaagctaaggatattaatatcgat
gagaacggaacatcttttaaagtcgatttagatagaggtcatctcgatattaatttatct
attttgggtgaacataatattcagaatgcacttgctgccatagccgccgcagtagcagct
caagtagatttaaaagctattgaaaatggtttaaaaaatttccagcctgtaaaaggtaga
cttcaaaaacatattcttaaagatggtgtaattgttgtggacgatacttataacgccaat
cctgattccgttatagcggctataaatatcttaaaaacattgccagctcctagaactctg
gttttgggggatatgggtgaggttggagaagatagccttcaaatgcatagcgaaatcggt
cgatacgctaaggcttctggtattgaacatttgctttctattggtgaggcttctgcacat
gcacaaaattcctttggcaatgttcacgctcatttctcaaatattgaggatttaattgaa
aaattaaaatctcttaactctaagtcaattattatcaagggttccagattcatgaagatg
gagagggttctcgaggctctaacgaaggattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system